PDB entry 4mrc

View 4mrc on RCSB PDB site
Description: Human Transthyretin Ser52Pro Mutant
Class: transport protein
Keywords: Hormone Transporter, Thyroxine T4, TRANSPORT PROTEIN
Deposited on 2013-09-17, released 2014-01-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-01-08, with a file datestamp of 2014-01-03.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.164
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (50)
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (50)
    Domains in SCOPe 2.03: d4mrcb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mrcB (B:)
    ptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsepgelhgltte
    eefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttav
    vtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mrcB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsepgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandgprrytiaallspysysttavvtn