PDB entry 4mrb

View 4mrb on RCSB PDB site
Description: Wild Type Human Transthyretin pH 7.5
Class: transport protein
Keywords: Hormone Transporter, Thyroxine T4, TRANSPORT PROTEIN
Deposited on 2013-09-17, released 2014-01-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 1.27 Å
R-factor: 0.168
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4mrba_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4mrbb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mrbA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mrbA (A:)
    cplmvkvldavrgspainvavhvfrkaadtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mrbB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mrbB (B:)
    cplmvkvldavrgspainvavhvfrkaawepfasgktsesgelhgltteeefvegiykve
    idtksywkalgispfhehaevvftanrytiaallspysysttavvt