PDB entry 4mqo

View 4mqo on RCSB PDB site
Description: Mycobaterium tuberculosis transaminase BioA complexed with 5,6-DIHYDRO-BENZO[H]CINNOLIN-3-YLAMINE
Class: transferase
Keywords: transaminase, Transferase
Deposited on 2013-09-16, released 2014-03-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.199
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bioA, Rv1568, MT1619, MTCY336.35c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mqoa_
  • Chain 'B':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bioA, Rv1568, MT1619, MTCY336.35c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mqob_
  • Heterogens: 2BG, 2B0, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mqoA (A:)
    mgsshhhhhhssglvprgshmaaatggltpeqiiavdgahlwhpyssigreavspvvava
    ahgawltlirdgqpievldamsswwtaihghghpaldqalttqlrvmnhvmfgglthepa
    arlakllvditpagldtvffsdsgsvsvevaakmalqywrgrglpgkrrlmtwrggyhgd
    tflamsicdphggmhslwtdvlaaqvfapqvprdydpaysaafeaqlaqhagelaavvve
    pvvqgaggmrfhdprylhdlrdicrryevllifdeiatgfgrtgalfaadhagvspdimc
    vgkaltggylslaatlctadvahtisagaagalmhgptfmanplacavsvasvelllgqd
    wrtritelaagltagldtaralpavtdvrvcgaigviecdrpvdlavatpaaldrgvwlr
    pfrnlvyamppyictpaeitqitsamvevarlvgslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mqoA (A:)
    ltpeqiiavdgahlwhpyssigrspvvavaahgawltlirdgqpievldamsswwtaihg
    hghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsvsvev
    aakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqvfapq
    vprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrryevl
    lifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtisagaa
    galmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavtdvrv
    cgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsamveva
    rlvgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mqoB (B:)
    mgsshhhhhhssglvprgshmaaatggltpeqiiavdgahlwhpyssigreavspvvava
    ahgawltlirdgqpievldamsswwtaihghghpaldqalttqlrvmnhvmfgglthepa
    arlakllvditpagldtvffsdsgsvsvevaakmalqywrgrglpgkrrlmtwrggyhgd
    tflamsicdphggmhslwtdvlaaqvfapqvprdydpaysaafeaqlaqhagelaavvve
    pvvqgaggmrfhdprylhdlrdicrryevllifdeiatgfgrtgalfaadhagvspdimc
    vgkaltggylslaatlctadvahtisagaagalmhgptfmanplacavsvasvelllgqd
    wrtritelaagltagldtaralpavtdvrvcgaigviecdrpvdlavatpaaldrgvwlr
    pfrnlvyamppyictpaeitqitsamvevarlvgslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mqoB (B:)
    gltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwt
    aihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsv
    svevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqv
    fapqvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrr
    yevllifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtis
    agaagalmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavt
    dvrvcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsam
    vevarlv