PDB entry 4mpr

View 4mpr on RCSB PDB site
Description: Benzoylformate Decarboxylase: Is the tetramer vital for activity?
Class: lyase
Keywords: ThDP-dependent, cytol, LYASE
Deposited on 2013-09-13, released 2014-08-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-08-27, with a file datestamp of 2014-08-22.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.125
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Benzoylformate decarboxylase
    Species: Pseudomonas putida [TaxId:303]
    Gene: MDLC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20906
      • engineered mutation (140)
    Domains in SCOPe 2.05: d4mpra1, d4mpra2, d4mpra3
  • Heterogens: CA, TPP, GOL, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mprA (A:)
    masvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqa
    srkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlpr
    plvkwsyepasaaevphamseaihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvs
    ssvrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprc
    pfptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtc
    dpleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfd
    tlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeper
    qviavigdgsanysisalwtaaqyniptifvimnngtygalrwfagvleaenvpgldvpg
    idfralakgygvqalkadnleqlkgslqealsakgpvlievstvspvkrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mprA (A:)
    asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
    rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
    lvkwsyepasaaevphamseaihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
    svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
    fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
    pleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfdt
    lndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeperq
    viavigdgsanysisalwtaaqyniptifvimnngtygalrwfagvleaenvpgldvpgi
    dfralakgygvqalkadnleqlkgslqealsakgpvlievstvsp