PDB entry 4mpm

View 4mpm on RCSB PDB site
Description: Wild-type human neuroglobin
Class: Apoptosis
Keywords: globin, oxygen supply, nitrite reductase, proto-porphyrin IX, brain neurons, Apoptosis
Deposited on 2013-09-13, released 2014-01-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.184
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuroglobin
    Species: Homo sapiens [TaxId:9606]
    Gene: NGB
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: neuroglobin
    Species: Homo sapiens [TaxId:9606]
    Gene: NGB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4mpmb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mpmB (B:)
    merpepelirqswravsrsplehgtvlfarlfalepdllplfqyncrqfsspedclsspe
    fldhirkvmlvidaavtnvedlssleeylaslgrkhravgvklssfstvgesllymlekc
    lgpaftpatraawsqlygavvqamsrgwdge
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mpmB (B:)
    erpepelirqswravsrsplehgtvlfarlfalepdllplfqyncrqfsspedclsspef
    ldhirkvmlvidaavtnvedlssleeylaslgrkhravgvklssfstvgesllymlekcl
    gpaftpatraawsqlygavvqamsrgwd