PDB entry 4mpl

View 4mpl on RCSB PDB site
Description: Crystal structure of BMP9 at 1.90 Angstrom
Class: cytokine
Keywords: growth factor/cytokine, CYTOKINE
Deposited on 2013-09-13, released 2014-09-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-02, with a file datestamp of 2021-05-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth/differentiation factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BMP9, GDF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4mpla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4mplA (A:)
shhhhhhagagshcqktslrvnfedigwdswiiapkeyeayeckggcffpladdvtptkh
aivqtlvhlkfptkvgkaccvptklspisvlykddmgvptlkyhyegmsvaecgcr

    Sequence, based on observed residues (ATOM records): (download) 
    >4mplA (A:)
agshcqktslrvnfedigwdswiiapkeyeayeckggcffpladdvtptkhaivqtlvhl
kfptkvgkaccvptklspisvlykddmgvptlkyhyegmsvaecgcr