PDB entry 4mpi

View 4mpi on RCSB PDB site
Description: Crystal structure of the chitin-binding module (CBM18) of a chitinase-like protein from Hevea brasiliensis
Deposited on 2013-09-12, released 2014-08-27
The last revision was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.18
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class I chitinase
    Species: Hevea brasiliensis subsp. brasiliensis [TaxId:187338]
    Gene: Hbchi-L1, laCIC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GUD7 (2-44)
      • expression tag (1)
  • Chain 'B':
    Compound: Class I chitinase
    Species: Hevea brasiliensis subsp. brasiliensis [TaxId:187338]
    Gene: Hbchi-L1, laCIC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GUD7 (2-44)
      • expression tag (0-1)
  • Heterogens: MES, DIO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4mpiA (A:)
ameqcgrqaggalcpgglccsqygwcantpeycgsgcqsqcdggv

    Sequence, based on observed residues (ATOM records):
    >4mpiA (A:)
meqcgrqaggalcpgglccsqygwcantpeycgsgcqsqcdggv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >4mpiB (B:)
ameqcgrqaggalcpgglccsqygwcantpeycgsgcqsqcdggv