PDB entry 4mou

View 4mou on RCSB PDB site
Description: Crystal Structure of an Enoyl-CoA Hydratase/Isomerase Family Member, NYSGRC target 028282
Class: isomerase
Keywords: isomerase, Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, Cronotase fold, enoyl-CoA hydratase/isomerase
Deposited on 2013-09-12, released 2013-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-CoA hydratase/isomerase family protein
    Species: Arthrobacter aurescens [TaxId:290340]
    Gene: AAur_3475
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4moua_
  • Chain 'B':
    Compound: Enoyl-CoA hydratase/isomerase family protein
    Species: Arthrobacter aurescens [TaxId:290340]
    Gene: AAur_3475
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4moub_
  • Chain 'C':
    Compound: Enoyl-CoA hydratase/isomerase family protein
    Species: Arthrobacter aurescens [TaxId:290340]
    Gene: AAur_3475
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mouc_
  • Heterogens: CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mouA (A:)
    mhhhhhhssgvdlgtenlyfqsmstvsevarprtgrisvaiadgvasveisnlaqrnalt
    kdmcleiqelmpqldadpdvavvvlrgagdtfcagasiselasvlldpqpdgstadhlsr
    adsaiaalskpavalvdgacmgggwqiasacdfiianeravigltpakigiiyprpgler
    lvrlvghanakyilltgqtfsapearalglvadvvpsesfeekcaalvrslrsrsrfsmh
    smkrlvdltdsvpaagidqewaaawsampdspdmgigisaflnreqprfmwrpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mouA (A:)
    arprtgrisvaiadgvasveisnlaqrnaltkdmcleiqelmpqldadpdvavvvlrgag
    dtfcagasiselasvlldpqpdgstadhlsradsaiaalskpavalvdgacmgggwqias
    acdfiianeravigltpakigiiyprpglerlvrlvghanakyilltgqtfsapearalg
    lvadvvpsesfeekcaalvrslrsrsrfsmhsmkrlvdltdsgidqewaaawsampdspd
    mgigisaflnreqprfmwrpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mouB (B:)
    mhhhhhhssgvdlgtenlyfqsmstvsevarprtgrisvaiadgvasveisnlaqrnalt
    kdmcleiqelmpqldadpdvavvvlrgagdtfcagasiselasvlldpqpdgstadhlsr
    adsaiaalskpavalvdgacmgggwqiasacdfiianeravigltpakigiiyprpgler
    lvrlvghanakyilltgqtfsapearalglvadvvpsesfeekcaalvrslrsrsrfsmh
    smkrlvdltdsvpaagidqewaaawsampdspdmgigisaflnreqprfmwrpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mouB (B:)
    arprtgrisvaiadgvasveisnlaqrnaltkdmcleiqelmpqldadpdvavvvlrgag
    dtfcagasiselasvlldpqpdgstadhlsradsaiaalskpavalvdgacmgggwqias
    acdfiianeravigltpakigiiyprpglerlvrlvghanakyilltgqtfsapearalg
    lvadvvpsesfeekcaalvrslrsrsrfsmhsmkrlvdltdsgidqewaaawsampdspd
    mgigisaflnreqprfmwrpa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4mouC (C:)
    mhhhhhhssgvdlgtenlyfqsmstvsevarprtgrisvaiadgvasveisnlaqrnalt
    kdmcleiqelmpqldadpdvavvvlrgagdtfcagasiselasvlldpqpdgstadhlsr
    adsaiaalskpavalvdgacmgggwqiasacdfiianeravigltpakigiiyprpgler
    lvrlvghanakyilltgqtfsapearalglvadvvpsesfeekcaalvrslrsrsrfsmh
    smkrlvdltdsvpaagidqewaaawsampdspdmgigisaflnreqprfmwrpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mouC (C:)
    tgrisvaiadgvasveisnlaqrnaltkdmcleiqelmpqldadpdvavvvlrgagdtfc
    agasiselasvlldpqpdgstadhlsradsaiaalskpavalvdgacmgggwqiasacdf
    iianeravigltpakigiiyprpglerlvrlvghanakyilltgqtfsapearalglvad
    vvpsesfeekcaalvrslrsrsrfsmhsmkrlvdltdsagidqewaaawsampdspdmgi
    gisaflnreqprfmwrpa