PDB entry 4mnv

View 4mnv on RCSB PDB site
Description: crystal structure of bicyclic peptide uk729 bound as an acyl-enzyme intermediate to urokinase-type plasminogen activator (upa)
Deposited on 2013-09-11, released 2014-02-05
The last revision was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urokinase-type plasminogen activator chain b
    Species: Homo sapiens [TaxId:9606]
    Gene: PLAU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00749 (0-244)
      • engineered mutation (120)
      • engineered mutation (143)
  • Chain 'B':
    Compound: acyl-enzyme intermediate of bicyclic peptide UK729
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 4MNV (0-9)
  • Chain 'C':
    Compound: acyl-enzyme intermediate of bicyclic peptide UK729
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 4MNV (0-End)
  • Heterogens: SO4, ACT, ZBR, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4mnvA (A:)
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irsht

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >4mnvB (B:)
tcrqsmctar

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >4mnvC (C:)
tcp