PDB entry 4mmz

View 4mmz on RCSB PDB site
Description: Integrin AlphaVBeta3 ectodomain bound to an antagonistic tenth domain of Fibronectin
Class: cell adhesion
Keywords: integrin, A domain, hybrid domain, PSI, EGF repeats, beta tail, calf, thigh, beta propeller, RGD motif, fibronectin, vitronectin, CELL ADHESION
Deposited on 2013-09-09, released 2014-03-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-V
    Species: Homo sapiens [TaxId:9606]
    Gene: alphav, ITGAV, MSK8, VNRA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mmza1, d4mmza2, d4mmza3, d4mmza4
  • Chain 'B':
    Compound: integrin beta-3
    Species: Homo sapiens [TaxId:9606]
    Gene: GP3A, ITGB3
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Fibronectin
    Species: Homo sapiens [TaxId:9606]
    Gene: FN1, FN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02751 (0-End)
      • engineered mutation (75)
      • engineered mutation (79-82)
    Domains in SCOPe 2.07: d4mmzc_
  • Heterogens: NAG, BMA, MAN, MN, NA, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mmzA (A:)
    fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
    wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
    erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
    gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
    sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
    mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
    aapyggedkkgivyifngrstglnavpsqilegqwaarsmppsfgysmkgatdidkngyp
    dlivgafgvdrailyrarpvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclk
    adgkgvlprklnfqvellldklkqkgairralflysrspshsknmtisrgglmqceelia
    ylrdesefrdkltpitifmeyrldyrtaadttglqpilnqftpanisrqahilldcgedn
    vckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvrnn
    ealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiqss
    nlfdkvspvvshkvdlavlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiy
    elrnngpssfskamlhlqwpykynnntllyilhydidgpmnctsdmeinplrikisslqt
    tekndtvagqgerdhlitkrdlalsegdihtlgcgvaqclkivcqvgrldrgksailyvk
    sllwtetfmnkenqnhsyslkssasfnviefpyknlpieditnstlvttnvtwgiqpap
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mmzA (A:)
    fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
    wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
    erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
    gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
    sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
    mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
    aapyggedkkgivyifngrstglnavpsqilegqwaarsmppsfgysmkgatdidkngyp
    dlivgafgvdrailyrarpvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclk
    adgkgvlprklnfqvellldklkqkgairralflysrspshsknmtisrgglmqceelia
    ylrdesefrdkltpitifmeyrldyrtaadttglqpilnqftpanisrqahilldcgedn
    vckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvrnn
    ealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiqss
    nlfdkvspvvshkvdlavlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiy
    elrnngpssfskamlhlqwpykynnntllyilhydidgpmnctsdmeinplrikihtlgc
    gvaqclkivcqvgrldrgksailyvksllwtetfmnkenqnhsyslkssasfnviefpyk
    nlpieditnstlvttnvtwg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4mmzC (C:)
    sdvprdlevvaatptslliswdapavtvryyritygetggnspvqeftvpgskstatisg
    lkpgvdytitvyavtprgdwnegskpisinyrtgkkgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mmzC (C:)
    sdvprdlevvaatptslliswdapavtvryyritygetggnspvqeftvpgskstatisg
    lkpgvdytitvyavtprgdwnegskpisiny