PDB entry 4mmw

View 4mmw on RCSB PDB site
Description: Crystal structure of D-glucarate dehydratase from Agrobacterium tumefaciens complexed with magnesium, L-Xylarohydroxamate and L-Lyxarohydroxamate
Class: isomerase
Keywords: enolase fold, D-GLUCARATE DEHYDRATASE, L-Xylarohydroxamate, L-Lyxarohydroxamate, ISOMERASE
Deposited on 2013-09-09, released 2013-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.171
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isomerase/lactonizing enzyme
    Species: Agrobacterium fabrum [TaxId:176299]
    Gene: Atu3453
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mmwa1, d4mmwa2
  • Chain 'B':
    Compound: isomerase/lactonizing enzyme
    Species: Agrobacterium fabrum [TaxId:176299]
    Gene: Atu3453
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mmwb1, d4mmwb2
  • Heterogens: MG, XYH, LLH, CL, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mmwA (A:)
    mgsshhhhhhssglvprgshmiimiitdvevrvfrtttrrhsdsaghahpgpahqveqam
    ltvrtedgqeghsftapeivrphviekfvkkvligedhrdrerlwqdlahwqrgsaaqlt
    drtlavvdcalwdlagrslgqpvykliggyrdkvlaygsimcgdelegglatpedygrfa
    etlvkrgykgiklhtwmppvswapdvkmdlkacaavreavgpdirlmidafhwysrtdal
    algrgleklgfdwieepmdeqslssykwlsdnldipvvgpesaagkhwhraewikagacd
    ilrtgvndvggitpalktmhlaeafgmecevhgntamnlhvvaatkncrwyergllhpfl
    eyddghdylkslsdpmdrdgfvhvpdrpglgedidftfidnnrvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mmwA (A:)
    miitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrph
    viekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpv
    ykliggyrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvswa
    pdvkmdlkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeqsl
    ssykwlsdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhlae
    afgmecevhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgfvh
    vpdrpglgedidftfidnnrv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mmwB (B:)
    mgsshhhhhhssglvprgshmiimiitdvevrvfrtttrrhsdsaghahpgpahqveqam
    ltvrtedgqeghsftapeivrphviekfvkkvligedhrdrerlwqdlahwqrgsaaqlt
    drtlavvdcalwdlagrslgqpvykliggyrdkvlaygsimcgdelegglatpedygrfa
    etlvkrgykgiklhtwmppvswapdvkmdlkacaavreavgpdirlmidafhwysrtdal
    algrgleklgfdwieepmdeqslssykwlsdnldipvvgpesaagkhwhraewikagacd
    ilrtgvndvggitpalktmhlaeafgmecevhgntamnlhvvaatkncrwyergllhpfl
    eyddghdylkslsdpmdrdgfvhvpdrpglgedidftfidnnrvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mmwB (B:)
    miitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrph
    viekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpv
    ykliggyrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvswa
    pdvkmdlkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeqsl
    ssykwlsdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhlae
    afgmecevhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgfvh
    vpdrpglgedidftfidnnrv