PDB entry 4mls

View 4mls on RCSB PDB site
Description: Crystal structure of the SpyTag and SpyCatcher-deltaN1 complex
Deposited on 2013-09-06, released 2013-11-13
The last revision was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.211
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibronectin binding protein
    Species: Streptococcus pyogenes [TaxId:1314]
    Gene: CnaB2, fba2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G9G1
      • engineered mutation (15)
      • engineered mutation (50)
  • Chain 'B':
    Compound: SpyTag
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 4MLS (0-End)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4mlsA (A:)
gsgdsathikfskrdedgkelagatmelrdssgktistwisdgqvkdfylypgkytfvet
aapdgyevataitftvneqgqvtvngkatkgdahi

    Sequence, based on observed residues (ATOM records):
    >4mlsA (A:)
sathikfskrdedgkelagatmelrdssgktistwisdgqvkdfylypgkytfvetaapd
gyevataitftvneqgqvtvn

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4mlsB (B:)
ahivmvdaykptk

    Sequence, based on observed residues (ATOM records):
    >4mlsB (B:)
ahivmvdaykpt