PDB entry 4mlp

View 4mlp on RCSB PDB site
Description: Mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase
Class: transcription
Keywords: photolyase homology region, transcriptional repressor, PERIOD, FBXL3, CLOCK, nucleus, TRANSCRIPTION
Deposited on 2013-09-06, released 2013-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.18
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cryptochrome-2
    Species: Mus musculus [TaxId:10090]
    Gene: Cry2, Kiaa0658
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mlpa1, d4mlpa2
  • Chain 'B':
    Compound: Cryptochrome-2
    Species: Mus musculus [TaxId:10090]
    Gene: Cry2, Kiaa0658
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mlpb1, d4mlpb2
  • Chain 'C':
    Compound: Cryptochrome-2
    Species: Mus musculus [TaxId:10090]
    Gene: Cry2, Kiaa0658
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mlpc1, d4mlpc2
  • Chain 'D':
    Compound: Cryptochrome-2
    Species: Mus musculus [TaxId:10090]
    Gene: Cry2, Kiaa0658
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mlpd1, d4mlpd2
  • Heterogens: 2CX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mlpA (A:)
    maaaavvaatvpaqsmgadgassvhwfrkglrlhdnpallaavrgarcvrcvyildpwfa
    asssvginrwrfllqsledldtslrklnsrlfvvrgqpadvfprlfkewgvtrltfeyds
    epfgkerdaaimkmakeagvevvtenshtlydldriielngqkppltykrfqalisrmel
    pkkpavavssqqmescraeiqenhddtygvpsleelgfpteglgpavwqggetealarld
    khlerkawvanyerprmnansllasptglspylrfgclscrlfyyrlwdlykkvkrnstp
    plslfgqllwreffytaatnnprfdrmegnpiciqipwdrnpealakwaegktgfpwida
    imtqlrqegwihhlarhavacfltrgdlwvswesgvrvfdellldadfsvnagswmwlsc
    saffqqffhcycpvgfgrrtdpsgdyirrylpklkgfpsryiyepwnapesvqkaakcii
    gvdyprpivnhaetsrlniermkqiyqqlsry
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mlpA (A:)
    assvhwfrkglrlhdnpallaavrgarcvrcvyildpwfaasssvginrwrfllqsledl
    dtslrklnsrlfvvrgqpadvfprlfkewgvtrltfeydsepfgkerdaaimkmakeagv
    evvtenshtlydldriielngqkppltykrfqalisrmelpkkpavavssqqmescraei
    qenhddtygvpsleelgfpteglgpavwqggetealarldkhlerkawvanyerprmnan
    sllasptglspylrfgclscrlfyyrlwdlykkvkrnstpplslfgqllwreffytaatn
    nprfdrmegnpiciqipwdrnpealakwaegktgfpwidaimtqlrqegwihhlarhava
    cfltrgdlwvswesgvrvfdellldadfsvnagswmwlscsaffqqffhcycpvgfgrrt
    dpsgdyirrylpklkgfpsryiyepwnapesvqkaakciigvdyprpivnhaetsrlnie
    rmkqiyqqlsry
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mlpB (B:)
    maaaavvaatvpaqsmgadgassvhwfrkglrlhdnpallaavrgarcvrcvyildpwfa
    asssvginrwrfllqsledldtslrklnsrlfvvrgqpadvfprlfkewgvtrltfeyds
    epfgkerdaaimkmakeagvevvtenshtlydldriielngqkppltykrfqalisrmel
    pkkpavavssqqmescraeiqenhddtygvpsleelgfpteglgpavwqggetealarld
    khlerkawvanyerprmnansllasptglspylrfgclscrlfyyrlwdlykkvkrnstp
    plslfgqllwreffytaatnnprfdrmegnpiciqipwdrnpealakwaegktgfpwida
    imtqlrqegwihhlarhavacfltrgdlwvswesgvrvfdellldadfsvnagswmwlsc
    saffqqffhcycpvgfgrrtdpsgdyirrylpklkgfpsryiyepwnapesvqkaakcii
    gvdyprpivnhaetsrlniermkqiyqqlsry
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mlpB (B:)
    assvhwfrkglrlhdnpallaavrgarcvrcvyildpwfaasssvginrwrfllqsledl
    dtslrklnsrlfvvrgqpadvfprlfkewgvtrltfeydsepfgkerdaaimkmakeagv
    evvtenshtlydldriielngqkppltykrfqalisrmelpkkpavavssqqmescraei
    qenhddtygvpsleelgfpteglgpavwqggetealarldkhlerkawvanyerprmnan
    sllasptglspylrfgclscrlfyyrlwdlykkvkrnstpplslfgqllwreffytaatn
    nprfdrmegnpiciqipwdrnpealakwaegktgfpwidaimtqlrqegwihhlarhava
    cfltrgdlwvswesgvrvfdellldadfsvnagswmwlscsaffqqffhcycpvgfgrrt
    dpsgdyirrylpklkgfpsryiyepwnapesvqkaakciigvdyprpivnhaetsrlnie
    rmkqiyqqlsry
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4mlpC (C:)
    maaaavvaatvpaqsmgadgassvhwfrkglrlhdnpallaavrgarcvrcvyildpwfa
    asssvginrwrfllqsledldtslrklnsrlfvvrgqpadvfprlfkewgvtrltfeyds
    epfgkerdaaimkmakeagvevvtenshtlydldriielngqkppltykrfqalisrmel
    pkkpavavssqqmescraeiqenhddtygvpsleelgfpteglgpavwqggetealarld
    khlerkawvanyerprmnansllasptglspylrfgclscrlfyyrlwdlykkvkrnstp
    plslfgqllwreffytaatnnprfdrmegnpiciqipwdrnpealakwaegktgfpwida
    imtqlrqegwihhlarhavacfltrgdlwvswesgvrvfdellldadfsvnagswmwlsc
    saffqqffhcycpvgfgrrtdpsgdyirrylpklkgfpsryiyepwnapesvqkaakcii
    gvdyprpivnhaetsrlniermkqiyqqlsry
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mlpC (C:)
    assvhwfrkglrlhdnpallaavrgarcvrcvyildpwfaasssvginrwrfllqsledl
    dtslrklnsrlfvvrgqpadvfprlfkewgvtrltfeydsepfgkerdaaimkmakeagv
    evvtenshtlydldriielngqkppltykrfqalisrmelpkkpavavssqqmescraei
    qenhddtygvpsleelgfpteglgpavwqggetealarldkhlerkawvanyerprmnan
    sllasptglspylrfgclscrlfyyrlwdlykkvkrnstpplslfgqllwreffytaatn
    nprfdrmegnpiciqipwdrnpealakwaegktgfpwidaimtqlrqegwihhlarhava
    cfltrgdlwvswesgvrvfdellldadfsvnagswmwlscsaffqqffhcycpvgfgrrt
    dpsgdyirrylpklkgfpsryiyepwnapesvqkaakciigvdyprpivnhaetsrlnie
    rmkqiyqqlsry
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4mlpD (D:)
    maaaavvaatvpaqsmgadgassvhwfrkglrlhdnpallaavrgarcvrcvyildpwfa
    asssvginrwrfllqsledldtslrklnsrlfvvrgqpadvfprlfkewgvtrltfeyds
    epfgkerdaaimkmakeagvevvtenshtlydldriielngqkppltykrfqalisrmel
    pkkpavavssqqmescraeiqenhddtygvpsleelgfpteglgpavwqggetealarld
    khlerkawvanyerprmnansllasptglspylrfgclscrlfyyrlwdlykkvkrnstp
    plslfgqllwreffytaatnnprfdrmegnpiciqipwdrnpealakwaegktgfpwida
    imtqlrqegwihhlarhavacfltrgdlwvswesgvrvfdellldadfsvnagswmwlsc
    saffqqffhcycpvgfgrrtdpsgdyirrylpklkgfpsryiyepwnapesvqkaakcii
    gvdyprpivnhaetsrlniermkqiyqqlsry
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mlpD (D:)
    assvhwfrkglrlhdnpallaavrgarcvrcvyildpwfaasssvginrwrfllqsledl
    dtslrklnsrlfvvrgqpadvfprlfkewgvtrltfeydsepfgkerdaaimkmakeagv
    evvtenshtlydldriielngqkppltykrfqalisrmelpkkpavavssqqmescraei
    qenhddtygvpsleelgfpteglgpavwqggetealarldkhlerkawvanyerprmnan
    sllasptglspylrfgclscrlfyyrlwdlykkvkrnstpplslfgqllwreffytaatn
    nprfdrmegnpiciqipwdrnpealakwaegktgfpwidaimtqlrqegwihhlarhava
    cfltrgdlwvswesgvrvfdellldadfsvnagswmwlscsaffqqffhcycpvgfgrrt
    dpsgdyirrylpklkgfpsryiyepwnapesvqkaakciigvdyprpivnhaetsrlnie
    rmkqiyqqlsry