PDB entry 4mla

View 4mla on RCSB PDB site
Description: Structure of maize cytokinin oxidase/dehydrogenase 2 (ZmCKO2)
Class: oxidoreductase
Keywords: oxidoreductase, fad binding protein, flavoprotein, cytokinin oxidase/dehydrogenase, cytokinin binding
Deposited on 2013-09-06, released 2015-03-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-04, with a file datestamp of 2015-10-30.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytokinin oxidase 2
    Species: Zea mays [TaxId:4577]
    Gene: cko2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mlaa1, d4mlaa2
  • Chain 'B':
    Compound: Cytokinin oxidase 2
    Species: Zea mays [TaxId:4577]
    Gene: cko2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mlab1, d4mlab2
  • Heterogens: FAD, IPA, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mlaA (A:)
    aghmrltmhvpdedmlsplgalrldghfsfhdvsamardfgnqcsflpaavlhpgsvsdi
    aatvrhvfslgegspltvaarghghslmgqsqaaqgivvrmeslrgarlqvhdgfvdapg
    gelwinvlretlkhglapkswtdylhltvggtlsnagvsgqafrhgpqvsnvnqleivtg
    rgdvvtcspednsdlfyaalgglgqfgiitrarialepapemvrwirvlysdfesftedq
    emlimaensfdyiegfviinrtgilnnwrasfkpqdpvqashfqsdgrvlycleltknfn
    sgdtdtmeqevavllsrlrfiqstlfhtdvtylefldrvhtselklraqslwevphpwln
    lliprssirrfatevfgrilkdsnngpillypvnkskwdnktsvvipdeeifylvgflss
    apslsghgsiahamslnsqivefceeadigmkqylahyttqeqwkthfgarwetferrkh
    rydplailapgqrifpkaslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mlaA (A:)
    dmlsplgalrldghfsfhdvsamardfgnqcsflpaavlhpgsvsdiaatvrhvfslgeg
    spltvaarghghslmgqsqaaqgivvrmeslrgarlqvhdgfvdapggelwinvlretlk
    hglapkswtdylhltvggtlsnagvsgqafrhgpqvsnvnqleivtgrgdvvtcspedns
    dlfyaalgglgqfgiitrarialepapemvrwirvlysdfesftedqemlimaensfdyi
    egfviinrtgilnnwrasfkpqdprvlycleltknfnsgdtdtmeqevavllsrlrfiqs
    tlfhtdvtylefldrvhtselklraqslwevphpwlnlliprssirrfatevfgrilkds
    nngpillypvnkskwdnktsvvipdeeifylvgflssapslsghgsiahamslnsqivef
    ceeadigmkqylahyttqeqwkthfgarwetferrkhrydplailapgqrifpkasl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mlaB (B:)
    aghmrltmhvpdedmlsplgalrldghfsfhdvsamardfgnqcsflpaavlhpgsvsdi
    aatvrhvfslgegspltvaarghghslmgqsqaaqgivvrmeslrgarlqvhdgfvdapg
    gelwinvlretlkhglapkswtdylhltvggtlsnagvsgqafrhgpqvsnvnqleivtg
    rgdvvtcspednsdlfyaalgglgqfgiitrarialepapemvrwirvlysdfesftedq
    emlimaensfdyiegfviinrtgilnnwrasfkpqdpvqashfqsdgrvlycleltknfn
    sgdtdtmeqevavllsrlrfiqstlfhtdvtylefldrvhtselklraqslwevphpwln
    lliprssirrfatevfgrilkdsnngpillypvnkskwdnktsvvipdeeifylvgflss
    apslsghgsiahamslnsqivefceeadigmkqylahyttqeqwkthfgarwetferrkh
    rydplailapgqrifpkaslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mlaB (B:)
    dmlsplgalrldghfsfhdvsamardfgnqcsflpaavlhpgsvsdiaatvrhvfslgeg
    spltvaarghghslmgqsqaaqgivvrmeslrgarlqvhdgfvdapggelwinvlretlk
    hglapkswtdylhltvggtlsnagvsgqafrhgpqvsnvnqleivtgrgdvvtcspedns
    dlfyaalgglgqfgiitrarialepapemvrwirvlysdfesftedqemlimaensfdyi
    egfviinrvlycleltknfnsgdtdtmeqevavllsrlrfiqstlfhtdvtylefldrvh
    tselklraqslwevphpwlnlliprssirrfatevfgrilkdsnngpillypvnkskwdn
    ktsvvipdeeifylvgflssapslsghgsiahamslnsqivefceeadigmkqylahytt
    qeqwkthfgarwetferrkhrydplailapgqrifpkasl