PDB entry 4mkv

View 4mkv on RCSB PDB site
Description: Structure of Pisum sativum Rubisco with ABA
Class: lyase
Keywords: rubisco, ribulose-1,5-bisphosphate, garden pea, abscisic acid, LYASE
Deposited on 2013-09-05, released 2013-10-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.164
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mkva1, d4mkva2
  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mkvb1, d4mkvb2
  • Chain 'C':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mkvc1, d4mkvc2
  • Chain 'D':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mkvd1, d4mkvd2
  • Chain 'S':
    Compound: Ribulose bisphosphate carboxylase small chain 3A, chloroplastic
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07689 (0-122)
      • conflict (46)
      • conflict (90-91)
      • conflict (95)
      • conflict (120-121)
    Domains in SCOPe 2.06: d4mkvs_
  • Chain 'T':
    Compound: Ribulose bisphosphate carboxylase small chain 3A, chloroplastic
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07689 (0-122)
      • conflict (46)
      • conflict (90-91)
      • conflict (95)
      • conflict (120-121)
    Domains in SCOPe 2.06: d4mkvt_
  • Chain 'U':
    Compound: Ribulose bisphosphate carboxylase small chain 3A, chloroplastic
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07689 (0-122)
      • conflict (46)
      • conflict (90-91)
      • conflict (95)
      • conflict (120-121)
    Domains in SCOPe 2.06: d4mkvu_
  • Chain 'V':
    Compound: Ribulose bisphosphate carboxylase small chain 3A, chloroplastic
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07689 (0-122)
      • conflict (46)
      • conflict (90-91)
      • conflict (95)
      • conflict (120-121)
    Domains in SCOPe 2.06: d4mkvv_
  • Heterogens: RUB, PO4, A8S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mkvA (A:)
    gfkagvkdykltyytpdyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwt
    dgltsldrykgrcyeiepvpgednqfiayvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripyayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaeaiyksqaetgeikghylnatagtceeml
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihagtvvgklegereitlgfvdllrddyikkdrsrgiyftqdwvsl
    pgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregnaiireackwspelaaacevwkeikfef
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mkvB (B:)
    gfkagvkdykltyytpdyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwt
    dgltsldrykgrcyeiepvpgednqfiayvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripyayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaeaiyksqaetgeikghylnatagtceeml
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihagtvvgklegereitlgfvdllrddyikkdrsrgiyftqdwvsl
    pgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregnaiireackwspelaaacevwkeikfef
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mkvC (C:)
    gfkagvkdykltyytpdyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwt
    dgltsldrykgrcyeiepvpgednqfiayvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripyayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaeaiyksqaetgeikghylnatagtceeml
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihagtvvgklegereitlgfvdllrddyikkdrsrgiyftqdwvsl
    pgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregnaiireackwspelaaacevwkeikfef
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mkvD (D:)
    gfkagvkdykltyytpdyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwt
    dgltsldrykgrcyeiepvpgednqfiayvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripyayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfcaeaiyksqaetgeikghylnatagtceeml
    kravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhf
    rvlakalrlsggdhihagtvvgklegereitlgfvdllrddyikkdrsrgiyftqdwvsl
    pgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqar
    negrdlaregnaiireackwspelaaacevwkeikfef
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mkvS (S:)
    mqvwppigkkkfetlsylppltrdqllkeveyllrkgwvpclefelkkgfvyrehnkspg
    yydgrywtmwklpmfgttdasqvlkeldevkkayprafvriigfdnvrqvqcisfiahtp
    agy
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mkvT (T:)
    mqvwppigkkkfetlsylppltrdqllkeveyllrkgwvpclefelkkgfvyrehnkspg
    yydgrywtmwklpmfgttdasqvlkeldevkkayprafvriigfdnvrqvqcisfiahtp
    agy
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mkvU (U:)
    mqvwppigkkkfetlsylppltrdqllkeveyllrkgwvpclefelkkgfvyrehnkspg
    yydgrywtmwklpmfgttdasqvlkeldevkkayprafvriigfdnvrqvqcisfiahtp
    agy
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mkvV (V:)
    mqvwppigkkkfetlsylppltrdqllkeveyllrkgwvpclefelkkgfvyrehnkspg
    yydgrywtmwklpmfgttdasqvlkeldevkkayprafvriigfdnvrqvqcisfiahtp
    agy