PDB entry 4mkn

View 4mkn on RCSB PDB site
Description: Crystal structure of chloroplastic triosephosphate isomerase from Chlamydomonas reinhardtii at 1.1 A of resolution
Class: isomerase
Keywords: TIM barrel, Isomerase, chloroplast
Deposited on 2013-09-05, released 2014-01-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.161
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: TIM, TPIC, CHLREDRAFT_26265
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mkna_
  • Heterogens: MRD, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mknA (A:)
    rssrasrsqrvevvcassakffvggnwkcngsvanvaklvdelnagtiprgvdvvvappf
    iyidyvmqhldrdkyqlsaqnawiggngaftgevsaeqltdfgvpwvilghserrslfge
    snevvakktshalaaglgviacigetleqrnsgsvfkvldaqmdalvdevkdwtkvvlay
    epvwaigtgvvaspeqaqevhaylrqycakklgaavadklriiyggsvsdtnckdlskqe
    didgflvggaslkgaafvticnaagpkakp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mknA (A:)
    ssakffvggnwkcngsvanvaklvdelnagtiprgvdvvvappfiyidyvmqhldrdkyq
    lsaqnawiggngaftgevsaeqltdfgvpwvilghserrslfgesnevvakktshalaag
    lgviacigetleqrnsgsvfkvldaqmdalvdevkdwtkvvlayepvwaigtgvvaspeq
    aqevhaylrqycakklgaavadklriiyggsvsdtnckdlskqedidgflvggaslkgaa
    fvticnaagpkakp