PDB entry 4mju

View 4mju on RCSB PDB site
Description: Influenza Neuraminidase in complex with a novel antiviral compound
Class: hydrolase/hydrolase inhibitor
Keywords: Sialidase, Neuraminidase, Viral protein, hydrolase-hydrolase inhibitor complex
Deposited on 2013-09-04, released 2014-01-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.186
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:385580]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07599 (0-388)
      • conflict (11)
      • conflict (133)
      • conflict (184)
      • conflict (212)
      • conflict (247)
    Domains in SCOPe 2.05: d4mjua_
  • Heterogens: 27S, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mjuA (A:)
    tymnnteaicdvkgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
    khsngtvkdrspfrtlmsvevgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
    vavihyggvptdvinswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
    iigqadisfngghieecscypndgkvecvcrdnwtgtnrpvlvispdlsyrvgylcagip
    sdtprgedaqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
    tqtskeqirkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
    ssivmcgvdyevadwswhdgailpfdidk