PDB entry 4mjs

View 4mjs on RCSB PDB site
Description: crystal structure of a PB1 complex
Class: transferase/protein binding
Keywords: PB1 domain, PB1 heterodimer and protein interaction, TRANSFERASE-PROTEIN BINDING complex
Deposited on 2013-09-04, released 2014-08-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.24
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein kinase C zeta type
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Pkcz, Prkcz
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09217 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d4mjsa1, d4mjsa2
  • Chain 'B':
    Compound: Sequestosome-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ORCA, OSIL, SQSTM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13501 (Start-103)
      • engineered mutation (70)
      • engineered mutation (72)
  • Chain 'C':
    Compound: Protein kinase C zeta type
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Pkcz, Prkcz
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09217 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d4mjsc1, d4mjsc2
  • Chain 'D':
    Compound: Sequestosome-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ORCA, OSIL, SQSTM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13501 (4-103)
      • engineered mutation (70)
      • engineered mutation (72)
  • Chain 'E':
    Compound: Protein kinase C zeta type
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Pkcz, Prkcz
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09217 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d4mjse1, d4mjse2
  • Chain 'F':
    Compound: Sequestosome-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ORCA, OSIL, SQSTM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13501 (4-103)
      • engineered mutation (70)
      • engineered mutation (72)
  • Chain 'G':
    Compound: Protein kinase C zeta type
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Pkcz, Prkcz
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09217 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d4mjsg1, d4mjsg2
  • Chain 'H':
    Compound: Sequestosome-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ORCA, OSIL, SQSTM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13501 (4-103)
      • engineered mutation (70)
      • engineered mutation (72)
  • Chain 'I':
    Compound: Protein kinase C zeta type
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Pkcz, Prkcz
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09217 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d4mjsi1, d4mjsi2
  • Chain 'J':
    Compound: Sequestosome-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ORCA, OSIL, SQSTM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13501 (4-103)
      • engineered mutation (70)
      • engineered mutation (72)
  • Chain 'K':
    Compound: Protein kinase C zeta type
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Pkcz, Prkcz
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09217 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d4mjsk1, d4mjsk2
  • Chain 'L':
    Compound: Sequestosome-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ORCA, OSIL, SQSTM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13501 (4-103)
      • engineered mutation (70)
      • engineered mutation (72)
  • Chain 'M':
    Compound: Protein kinase C zeta type
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Pkcz, Prkcz
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09217 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d4mjsm1, d4mjsm2
  • Chain 'N':
    Compound: Sequestosome-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ORCA, OSIL, SQSTM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13501 (4-103)
      • engineered mutation (70)
      • engineered mutation (72)
  • Chain 'O':
    Compound: Protein kinase C zeta type
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Pkcz, Prkcz
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09217 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d4mjso1, d4mjso2
  • Chain 'P':
    Compound: Sequestosome-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ORCA, OSIL, SQSTM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13501 (Start-103)
      • engineered mutation (70)
      • engineered mutation (72)
  • Chain 'Q':
    Compound: Protein kinase C zeta type
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Pkcz, Prkcz
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09217 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d4mjsq1, d4mjsq2
  • Chain 'R':
    Compound: Sequestosome-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ORCA, OSIL, SQSTM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13501 (4-103)
      • engineered mutation (70)
      • engineered mutation (72)
  • Chain 'S':
    Compound: Protein kinase C zeta type
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Pkcz, Prkcz
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09217 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d4mjss1, d4mjss2
  • Chain 'T':
    Compound: Sequestosome-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ORCA, OSIL, SQSTM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13501 (4-103)
      • engineered mutation (70)
      • engineered mutation (72)
  • Chain 'U':
    Compound: Protein kinase C zeta type
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Pkcz, Prkcz
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09217 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d4mjsu1, d4mjsu2
  • Chain 'V':
    Compound: Sequestosome-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ORCA, OSIL, SQSTM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13501
      • engineered mutation (70)
      • engineered mutation (72)
  • Chain 'W':
    Compound: Protein kinase C zeta type
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Pkcz, Prkcz
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09217 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.06: d4mjsw1, d4mjsw2
  • Chain 'X':
    Compound: Sequestosome-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ORCA, OSIL, SQSTM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13501 (4-103)
      • expression tag (3)
      • engineered mutation (70)
      • engineered mutation (72)
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mjsA (A:)
    gphmrvrlkahyggdilitsvdptttfqdlceevrdmcglhqqhpltlkwvdsegdpctv
    ssqmeleeafrlacqgrdevliihvfpsipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mjsA (A:)
    phmrvrlkahyggdilitsvdtttfqdlceevrdmcglhqqhpltlkwvdsegdpctvss
    qmeleeafrlacqgrdevliihvfpsip
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4mjsC (C:)
    gphmrvrlkahyggdilitsvdptttfqdlceevrdmcglhqqhpltlkwvdsegdpctv
    ssqmeleeafrlacqgrdevliihvfpsipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mjsC (C:)
    phmrvrlkahyggdilitsvdtttfqdlceevrdmcglhqqhpltlkwvdsegdpctvss
    qmeleeafrlacqgrdevliihvfpsip
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4mjsE (E:)
    gphmrvrlkahyggdilitsvdptttfqdlceevrdmcglhqqhpltlkwvdsegdpctv
    ssqmeleeafrlacqgrdevliihvfpsipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mjsE (E:)
    phmrvrlkahyggdilitsvdtttfqdlceevrdmcglhqqhpltlkwvdsegdpctvss
    qmeleeafrlacqgrdevliihvfpsip
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4mjsG (G:)
    gphmrvrlkahyggdilitsvdptttfqdlceevrdmcglhqqhpltlkwvdsegdpctv
    ssqmeleeafrlacqgrdevliihvfpsipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mjsG (G:)
    phmrvrlkahyggdilitsvdtttfqdlceevrdmcglhqqhpltlkwvdsegdpctvss
    qmeleeafrlacqgrdevliihvfpsip
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4mjsI (I:)
    gphmrvrlkahyggdilitsvdptttfqdlceevrdmcglhqqhpltlkwvdsegdpctv
    ssqmeleeafrlacqgrdevliihvfpsipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mjsI (I:)
    phmrvrlkahyggdilitsvdtttfqdlceevrdmcglhqqhpltlkwvdsegdpctvss
    qmeleeafrlacqgrdevliihvfpsip
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4mjsK (K:)
    gphmrvrlkahyggdilitsvdptttfqdlceevrdmcglhqqhpltlkwvdsegdpctv
    ssqmeleeafrlacqgrdevliihvfpsipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mjsK (K:)
    phmrvrlkahyggdilitsvdtttfqdlceevrdmcglhqqhpltlkwvdsegdpctvss
    qmeleeafrlacqgrdevliihvfpsip
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4mjsM (M:)
    gphmrvrlkahyggdilitsvdptttfqdlceevrdmcglhqqhpltlkwvdsegdpctv
    ssqmeleeafrlacqgrdevliihvfpsipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mjsM (M:)
    phmrvrlkahyggdilitsvdtttfqdlceevrdmcglhqqhpltlkwvdsegdpctvss
    qmeleeafrlacqgrdevliihvfpsip
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4mjsO (O:)
    gphmrvrlkahyggdilitsvdptttfqdlceevrdmcglhqqhpltlkwvdsegdpctv
    ssqmeleeafrlacqgrdevliihvfpsipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mjsO (O:)
    phmrvrlkahyggdilitsvdtttfqdlceevrdmcglhqqhpltlkwvdsegdpctvss
    qmeleeafrlacqgrdevliihvfpsip
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4mjsQ (Q:)
    gphmrvrlkahyggdilitsvdptttfqdlceevrdmcglhqqhpltlkwvdsegdpctv
    ssqmeleeafrlacqgrdevliihvfpsipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mjsQ (Q:)
    phmrvrlkahyggdilitsvdtttfqdlceevrdmcglhqqhpltlkwvdsegdpctvss
    qmeleeafrlacqgrdevliihvfpsip
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4mjsS (S:)
    gphmrvrlkahyggdilitsvdptttfqdlceevrdmcglhqqhpltlkwvdsegdpctv
    ssqmeleeafrlacqgrdevliihvfpsipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mjsS (S:)
    phmrvrlkahyggdilitsvdtttfqdlceevrdmcglhqqhpltlkwvdsegdpctvss
    qmeleeafrlacqgrdevliihvfpsip
    

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4mjsU (U:)
    gphmrvrlkahyggdilitsvdptttfqdlceevrdmcglhqqhpltlkwvdsegdpctv
    ssqmeleeafrlacqgrdevliihvfpsipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mjsU (U:)
    phmrvrlkahyggdilitsvdtttfqdlceevrdmcglhqqhpltlkwvdsegdpctvss
    qmeleeafrlacqgrdevliihvfpsip
    

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4mjsW (W:)
    gphmrvrlkahyggdilitsvdptttfqdlceevrdmcglhqqhpltlkwvdsegdpctv
    ssqmeleeafrlacqgrdevliihvfpsipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mjsW (W:)
    phmrvrlkahyggdilitsvdtttfqdlceevrdmcglhqqhpltlkwvdsegdpctvss
    qmeleeafrlacqgrdevliihvfpsip
    

  • Chain 'X':
    No sequence available.