PDB entry 4mjj

View 4mjj on RCSB PDB site
Description: Crystal structure of the C2A domain of DOC2A
Class: metal binding protein
Keywords: C2 domain, DOC2A, calcium binding protein, METAL BINDING PROTEIN
Deposited on 2013-09-03, released 2013-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Double C2-like domain-containing protein alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: DOC2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mjja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mjjA (A:)
    gsydsddatalgtlefdllydrasctlhcsilrakglkpmdfngladpyvklhllpgack
    anklktktqrntlnpvwnedltysgitdddithkvlriavcdedklshnefigeirvplr
    rlkpsqkkhfniclerqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mjjA (A:)
    algtlefdllydrasctlhcsilrakglkpdpyvklhllpgackanklktktqrntlnpv
    wnedltysgitdddithkvlriavcdedefigeirvplrrlkpsqkkhfniclerq