PDB entry 4mhv

View 4mhv on RCSB PDB site
Description: Crystal structure of the PNT domain of human ETS2
Class: transcription
Keywords: PNT (pointed) domain, TRANSCRIPTION, TRANSCRIPTION FACTOR
Deposited on 2013-08-30, released 2013-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.231
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein c-ets-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ETS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mhva_
  • Chain 'B':
    Compound: protein c-ets-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ETS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15036 (2-96)
      • expression tag (1)
    Domains in SCOPe 2.07: d4mhvb1, d4mhvb2
  • Heterogens: CA, GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mhvA (A:)
    smkavmsqalkatfsgfkkeqrrlgipknpwlwseqqvcqwllwatnefslvnvnlqrfg
    mngqmlcnlgkerflelapdfvgdilwehleqmiken
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhvA (A:)
    avmsqalkatfsgfkkeqrrlgipknpwlwseqqvcqwllwatnefslvnvnlqrfgmng
    qmlcnlgkerflelapdfvgdilwehleqmiken
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mhvB (B:)
    smkavmsqalkatfsgfkkeqrrlgipknpwlwseqqvcqwllwatnefslvnvnlqrfg
    mngqmlcnlgkerflelapdfvgdilwehleqmiken
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhvB (B:)
    mkavmsqalkatfsgfkkeqrrlgipknpwlwseqqvcqwllwatnefslvnvnlqrfgm
    ngqmlcnlgkerflelapdfvgdilwehleqmiken