PDB entry 4mht

View 4mht on RCSB PDB site
Description: ternary structure of hhai methyltransferase with native DNA and adohcy
Class: transferase/DNA
Keywords: complex (methyltransferase/DNA), transferase, methyltransferase, restriction system
Deposited on 1996-07-24, released 1997-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.178
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hhai methyltransferase (e.c.2.1.1.73))
    Species: Haemophilus haemolyticus [TaxId:726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mhta_
  • Chain 'C':
    Compound: DNA (5'-d(*gp*ap*tp*ap*gp*(5cm)p*gp*cp*tp*ap*tp*c)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*gp*ap*tp*ap*gp*(5cm)p*gp*cp*tp*ap*tp*c)-3')
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mhtA (A:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
    vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
    qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
    iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
    qfgnsvvinvlqyiaynigsslnfkpy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.