PDB entry 4mhi

View 4mhi on RCSB PDB site
Description: Crystal structure of a H5N1 influenza virus hemagglutinin from A/goose/Guangdong/1/96
Class: viral protein
Keywords: H5N1 influenza virus, epitope, glycoprotein, progenitor, VIRAL PROTEIN
Deposited on 2013-08-29, released 2013-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.192
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:93838]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Q0U6 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4mhia1, d4mhia2
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:93838]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mhib_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:93838]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Q0U6 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4mhic1, d4mhic2
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:93838]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mhid_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:93838]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Q0U6 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4mhie1, d4mhie2
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:93838]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mhif_
  • Chain 'G':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:93838]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Q0U6 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4mhig1, d4mhig2
  • Chain 'H':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:93838]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mhih_
  • Chain 'I':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:93838]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Q0U6 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4mhii1, d4mhii2
  • Chain 'J':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:93838]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mhij_
  • Chain 'K':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:93838]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Q0U6 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4mhik1, d4mhik2
  • Chain 'L':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:93838]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mhil_
  • Chain 'M':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:93838]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Q0U6 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4mhim1, d4mhim2
  • Chain 'N':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:93838]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mhin_
  • Chain 'O':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:93838]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Q0U6 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4mhio1, d4mhio2
  • Chain 'P':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:93838]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mhip_
  • Chain 'Q':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:93838]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Q0U6 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4mhiq1, d4mhiq2
  • Chain 'R':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:93838]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4mhir_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mhiA (A:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcs
    vagwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqi
    ipksswsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrntpqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhiA (A:)
    pgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcsva
    gwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqiip
    ksswsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlwgi
    hhpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpnda
    infesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplt
    igecpkyvksnrlvlatglrntp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mhiB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreeisgsgrlv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhiB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreei
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4mhiC (C:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcs
    vagwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqi
    ipksswsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrntpqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhiC (C:)
    pgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcsva
    gwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqiip
    ksswsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlwgi
    hhpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpnda
    infesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplt
    igecpkyvksnrlvlatglrntp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4mhiD (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreeisgsgrlv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhiD (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreei
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4mhiE (E:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcs
    vagwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqi
    ipksswsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrntpqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhiE (E:)
    pgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcsva
    gwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqiip
    ksswsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlwgi
    hhpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpnda
    infesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplt
    igecpkyvksnrlvlatglrntp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4mhiF (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreeisgsgrlv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhiF (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreei
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4mhiG (G:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcs
    vagwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqi
    ipksswsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrntpqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhiG (G:)
    pgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcsva
    gwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqiip
    ksswsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlwgi
    hhpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpnda
    infesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplt
    igecpkyvksnrlvlatglrntp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4mhiH (H:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreeisgsgrlv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhiH (H:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreei
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4mhiI (I:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcs
    vagwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqi
    ipksswsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrntpqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhiI (I:)
    pgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcsva
    gwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqiip
    ksswsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlwgi
    hhpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpnda
    infesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplt
    igecpkyvksnrlvlatglrntp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4mhiJ (J:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreeisgsgrlv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhiJ (J:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreei
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4mhiK (K:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcs
    vagwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqi
    ipksswsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrntpqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhiK (K:)
    pgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcsva
    gwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqiip
    ksswsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlwgi
    hhpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpnda
    infesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplt
    igecpkyvksnrlvlatglrntp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4mhiL (L:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreeisgsgrlv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhiL (L:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreei
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4mhiM (M:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcs
    vagwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqi
    ipksswsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrntpqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhiM (M:)
    pgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcsva
    gwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqiip
    ksswsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlwgi
    hhpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpnda
    infesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplt
    igecpkyvksnrlvlatglrntp
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4mhiN (N:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreeisgsgrlv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhiN (N:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreei
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4mhiO (O:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcs
    vagwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqi
    ipksswsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrntpqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhiO (O:)
    pgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcsva
    gwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqiip
    ksswsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlwgi
    hhpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpnda
    infesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplt
    igecpkyvksnrlvlatglrntp
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4mhiP (P:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreeisgsgrlv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhiP (P:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreei
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4mhiQ (Q:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcs
    vagwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqi
    ipksswsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrntpqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhiQ (Q:)
    pgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcsva
    gwllgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqiip
    ksswsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlwgi
    hhpndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpnda
    infesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplt
    igecpkyvksnrlvlatglrntp
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4mhiR (R:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreeisgsgrlv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mhiR (R:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreei