PDB entry 4mgy

View 4mgy on RCSB PDB site
Description: Selective activation of Epac1 and Epac2
Class: signaling protein/GTP-binding protein
Keywords: Guanine Nucleotide Exchange Factor, Nucleotide Binding, SIGNALING PROTEIN-GTP-BINDING PROTEIN complex
Deposited on 2013-08-29, released 2014-09-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: rap guanine nucleotide exchange factor 4
    Species: Mus musculus [TaxId:10090]
    Gene: Rapgef4, Cgef2, Epac2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EQZ6
      • engineered mutation (105)
  • Chain 'R':
    Compound: Ras-related protein Rap-1b
    Species: Homo sapiens [TaxId:9606]
    Gene: RAP1B, OK/SW-cl.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4mgyr_
  • Heterogens: H07, SO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download) 
    >4mgyR (R:)
mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr

    Sequence, based on observed residues (ATOM records): (download) 
    >4mgyR (R:)
eyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvqcmleildtagteqftam
rdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdledervvg
keqgqnlaflessakskinvneifydlvrq