PDB entry 4mge

View 4mge on RCSB PDB site
Description: 1.85 angstrom resolution crystal structure of pts system cellobiose- specific transporter subunit iib from bacillus anthracis.
Deposited on 2013-08-28, released 2013-09-11
The last revision was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PTS system, cellobiose-specific IIB component
    Species: Bacillus anthracis [TaxId:261594]
    Gene: celA2, BA_5444, BAS5059, GBAA_5444
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81X06 (0-99)
      • expression tag (100-107)
  • Chain 'B':
    Compound: PTS system, cellobiose-specific IIB component
    Species: Bacillus anthracis [TaxId:261594]
    Gene: celA2, BA_5444, BAS5059, GBAA_5444
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81X06 (0-99)
      • expression tag (100-106)
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4mgeA (A:)
    mnillccsagmstsllvtkmeaaakarglegkiwavsgdavktnidqadvlllgpqvrym
    lssmktladernvgidvinpmhygmmngeavldhaltlkkgenlyfqsaghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >4mgeA (A:)
    mnillccsagmstsllvtkmeaaakarglegkiwavsgdavktnidqadvlllgpqvrym
    lssmktladernvgidvinpmhygmmngeavldhaltlkkgenlyfqs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4mgeB (B:)
    mnillccsagmstsllvtkmeaaakarglegkiwavsgdavktnidqadvlllgpqvrym
    lssmktladernvgidvinpmhygmmngeavldhaltlkkgenlyfqsaghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >4mgeB (B:)
    mnillccsagmstsllvtkmeaaakarglegkiwavsgdavktnidqadvlllgpqvrym
    lssmktladernvgidvinpmhygmmngeavldhaltlkkgenlyfq