PDB entry 4mfg

View 4mfg on RCSB PDB site
Description: 2.0 Angstrom Resolution Crystal Structure of Putative Carbonic Anhydrase from Clostridium difficile.
Class: transferase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases, CSGID, Single-stranded left-handed beta-helix, gamma-carbonic anhydrase-like, TRANSFERASE
Deposited on 2013-08-27, released 2013-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative acyltransferase
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD630_27480
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q183I2 (3-167)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4mfga1, d4mfga2
  • Chain 'B':
    Compound: Putative acyltransferase
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD630_27480
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q183I2 (3-167)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4mfgb1, d4mfgb2
  • Chain 'C':
    Compound: Putative acyltransferase
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD630_27480
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q183I2 (3-167)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4mfgc1, d4mfgc2
  • Chain 'D':
    Compound: Putative acyltransferase
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD630_27480
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q183I2 (3-167)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4mfgd1, d4mfgd2
  • Heterogens: MG, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mfgA (A:)
    snamirdyledkplidesvfvaksadvignvkigkdssiwynavvrgdegpitigentni
    qdcsivhgdtetiignnvtvghrsivhgckisdnvligmgsiildnaeigeytligagtl
    itsnkkfppgvlimgspgkvvrelteedkkyidesyewyleaaqnqky
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mfgB (B:)
    snamirdyledkplidesvfvaksadvignvkigkdssiwynavvrgdegpitigentni
    qdcsivhgdtetiignnvtvghrsivhgckisdnvligmgsiildnaeigeytligagtl
    itsnkkfppgvlimgspgkvvrelteedkkyidesyewyleaaqnqky
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mfgC (C:)
    snamirdyledkplidesvfvaksadvignvkigkdssiwynavvrgdegpitigentni
    qdcsivhgdtetiignnvtvghrsivhgckisdnvligmgsiildnaeigeytligagtl
    itsnkkfppgvlimgspgkvvrelteedkkyidesyewyleaaqnqky
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mfgD (D:)
    snamirdyledkplidesvfvaksadvignvkigkdssiwynavvrgdegpitigentni
    qdcsivhgdtetiignnvtvghrsivhgckisdnvligmgsiildnaeigeytligagtl
    itsnkkfppgvlimgspgkvvrelteedkkyidesyewyleaaqnqky