PDB entry 4med

View 4med on RCSB PDB site
Description: Crystal structure of Ser/Thr kinase Pim1 in complex with thioridazine derivatives
Class: transferase/transferase inhibitor
Keywords: Protein-ligand complex, Kinase, Oncogene, ATP binding, Phosphorylation, Nucleus, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-08-26, released 2014-02-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.181
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4meda_
  • Heterogens: RTX

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4medA (A:)
    gphmkekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngt
    rvpmevvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeela
    rsffwqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgt
    rvysppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecq
    hlirwclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4medA (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlh