PDB entry 4mdq

View 4mdq on RCSB PDB site
Description: Structure of a novel submicromolar MDM2 inhibitor
Class: ligase/ligase inhibitor
Keywords: MDM2, p53, cancer, small molecule, LIGASE-LIGASE INHIBITOR complex
Deposited on 2013-08-23, released 2013-11-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.186
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4mdqa_
  • Heterogens: 28W, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4mdqA (A:)
etlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvvv