PDB entry 4mdn

View 4mdn on RCSB PDB site
Description: Structure of a novel submicromolar MDM2 inhibitor
Class: ligase/ligase inhibitor
Keywords: MDM2, p53, cancer, small molecule, LIGASE-LIGASE INHIBITOR complex
Deposited on 2013-08-23, released 2013-11-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.181
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: E3 ubiquitin-protein ligase Mdm2
  Species: Homo sapiens [TaxId:9606]
  Gene: MDM2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q00987 (1-93)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d4mdna1, d4mdna2
• Heterogens: Y30, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4mdnA (A:)
  mqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
  csndllgdlfgvpsfsvkehrkiytmiyrnlvvv