PDB entry 4mdf

View 4mdf on RCSB PDB site
Description: Structure of bacterial polynucleotide kinase Michaelis complex bound to GTP and DNA
Deposited on 2013-08-22, released 2013-11-06
The last revision was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.166
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Metallophosphoesterase
  Species: Clostridium thermocellum [TaxId:203119]
  Gene: Cthe_2768
  Database cross-references and differences (RAF-indexed):
  • Uniprot A3DJ38 (1-170)
    • expression tag (0)
    • engineered mutation (38)
    • engineered mutation (137)
• Chain 'B':
  Compound: Metallophosphoesterase
  Species: Clostridium thermocellum [TaxId:203119]
  Gene: Cthe_2768
  Database cross-references and differences (RAF-indexed):
  • Uniprot A3DJ38 (1-170)
    • expression tag (0)
    • engineered mutation (38)
    • engineered mutation (137)
• Chain 'C':
  Compound: DNA (5'-d(*cp*cp*tp*gp*t)-3')
  Species: synthetic, synthetic
  
• Chain 'D':
  Compound: DNA (5'-d(*cp*cp*tp*gp*t)-3')
  Species: synthetic, synthetic
  
• Heterogens: GTP, MG, CIT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >4mdfA (A:)
  smkltipelslvvligssgsgkstfakkhfkptevissnfcrglvsddendqtvtgaafd
  vlhyivskrlqlgkltvvdatnvqesarkplieiakdyhcfpvavvfnlpekvcqernkn
  rtdrqveeyvirkhtqqmkksikglqregfryvyilnspeeveevvferqp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >4mdfB (B:)
  smkltipelslvvligssgsgkstfakkhfkptevissnfcrglvsddendqtvtgaafd
  vlhyivskrlqlgkltvvdatnvqesarkplieiakdyhcfpvavvfnlpekvcqernkn
  rtdrqveeyvirkhtqqmkksikglqregfryvyilnspeeveevvferqp
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.