PDB entry 4md7

View 4md7 on RCSB PDB site
Description: Crystal Structure of full-length symmetric CK2 holoenzyme
Class: transferase
Keywords: protein serine/threonine kinase, TRANSFERASE
Deposited on 2013-08-22, released 2013-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.235
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK2B, CK2N, G5A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4md7a_
  • Chain 'B':
    Compound: Casein kinase II subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK2B, CK2N, G5A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4md7b_
  • Chain 'C':
    Compound: Casein kinase II subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK2B, CK2N, G5A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4md7c_
  • Chain 'D':
    Compound: Casein kinase II subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK2B, CK2N, G5A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4md7d_
  • Chain 'E':
    Compound: Casein kinase II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK2A1, CK2A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4md7e_
  • Chain 'F':
    Compound: Casein kinase II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK2A1, CK2A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4md7f_
  • Chain 'G':
    Compound: Casein kinase II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK2A1, CK2A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4md7g_
  • Chain 'H':
    Compound: Casein kinase II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK2A1, CK2A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4md7h_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4md7A (A:)
    mssseevswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepde
    elednpnqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpml
    piglsdipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpa
    nqfvprlygfkihpmayqlqlqaasnfkspvktir
    

    Sequence, based on observed residues (ATOM records): (download)
    >4md7A (A:)
    evswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdednpnq
    sdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpiglsdip
    geamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvprly
    gfkihpmayqlqlqaasnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4md7B (B:)
    mssseevswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepde
    elednpnqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpml
    piglsdipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpa
    nqfvprlygfkihpmayqlqlqaasnfkspvktir
    

    Sequence, based on observed residues (ATOM records): (download)
    >4md7B (B:)
    vswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdpnqsdli
    eqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpiglsdipgeam
    vklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvprlygfki
    hpmayqlqlqaasnf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4md7C (C:)
    mssseevswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepde
    elednpnqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpml
    piglsdipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpa
    nqfvprlygfkihpmayqlqlqaasnfkspvktir
    

    Sequence, based on observed residues (ATOM records): (download)
    >4md7C (C:)
    evswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdnpnqsd
    lieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpiglsdipge
    amvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvprlygf
    kihpmayqlqlqaasnf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4md7D (D:)
    mssseevswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepde
    elednpnqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpml
    piglsdipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpa
    nqfvprlygfkihpmayqlqlqaasnfkspvktir
    

    Sequence, based on observed residues (ATOM records): (download)
    >4md7D (D:)
    vswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdpnqsdli
    eqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpiglsdipgeam
    vklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvprlygfki
    hpmayqlqlqaasnf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4md7E (E:)
    msgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainit
    nnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntd
    fkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglae
    fyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnyd
    qlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdf
    ldkllrydhqsrltareamehpyfytvvkdqarmgsssmpggsepvssanmmsgissvpe
    peplgplagepviaaanplgmpvpaaagaqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4md7E (E:)
    sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
    nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
    kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
    yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
    lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
    dkllrydhqsrltareamehpyfytvvkdqar
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4md7F (F:)
    msgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainit
    nnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntd
    fkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglae
    fyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnyd
    qlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdf
    ldkllrydhqsrltareamehpyfytvvkdqarmgsssmpggsepvssanmmsgissvpe
    peplgplagepviaaanplgmpvpaaagaqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4md7F (F:)
    sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
    nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
    kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
    yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
    lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
    dkllrydhqsrltareamehpyfytvvkdqar
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4md7G (G:)
    msgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainit
    nnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntd
    fkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglae
    fyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnyd
    qlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdf
    ldkllrydhqsrltareamehpyfytvvkdqarmgsssmpggsepvssanmmsgissvpe
    peplgplagepviaaanplgmpvpaaagaqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4md7G (G:)
    sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
    nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
    kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
    yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
    lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
    dkllrydhqsrltareamehpyfytvvkdqar
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4md7H (H:)
    msgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainit
    nnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntd
    fkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglae
    fyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnyd
    qlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdf
    ldkllrydhqsrltareamehpyfytvvkdqarmgsssmpggsepvssanmmsgissvpe
    peplgplagepviaaanplgmpvpaaagaqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4md7H (H:)
    pvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitnne
    kvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfkq
    lyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefyh
    pgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydqlv
    riakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfldk
    llrydhqsrltareamehpyfytvvkdqar