PDB entry 4mct

View 4mct on RCSB PDB site
Description: P. vulgaris HIGBA structure, crystal form 1
Class: toxin
Keywords: bacterial toxins, biofilms, cell metabolism, energy metabolism, helix-turn-helix transcription factors, microbial pathogenesis, stress response, stringent response, transcription repressor, translation control, TOXIN
Deposited on 2013-08-21, released 2013-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antidote protein
    Species: Proteus vulgaris [TaxId:585]
    Gene: higa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4mcta_
  • Chain 'B':
    Compound: Killer protein
    Species: Proteus vulgaris [TaxId:585]
    Gene: higB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A225 (1-End)
      • expression tag (0)
  • Chain 'C':
    Compound: Antidote protein
    Species: Proteus vulgaris [TaxId:585]
    Gene: higa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4mctc_
  • Chain 'D':
    Compound: Killer protein
    Species: Proteus vulgaris [TaxId:585]
    Gene: higB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A225 (1-92)
      • expression tag (0)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4mctA (A:)
mrqfkvshpgemiardledmgvsgrrfahnigvtpatvsrllagktaltpslsiriaaal
gstpefwlrlqsnydlrqlenqidtsgivlygesneqqqnaqehdpnsssvdklaaaleh
hhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >4mctA (A:)
mrqfkvshpgemiardledmgvsgrrfahnigvtpatvsrllagktaltpslsiriaaal
gstpefwlrlqsnydlrqlenqidtsgivlyg

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >4mctC (C:)
mrqfkvshpgemiardledmgvsgrrfahnigvtpatvsrllagktaltpslsiriaaal
gstpefwlrlqsnydlrqlenqidtsgivlygesneqqqnaqehdpnsssvdklaaaleh
hhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >4mctC (C:)
mrqfkvshpgemiardledmgvsgrrfahnigvtpatvsrllagktaltpslsiriaaal
gstpefwlrlqsnydlrqlenqidtsgivlyge

  • Chain 'D':
    No sequence available.