PDB entry 4mck

View 4mck on RCSB PDB site
Description: Crystal structure of Family GH19, Class IV chitinase from Zea mays
Class: hydrolase
Keywords: hydrolase
Deposited on 2013-08-21, released 2014-03-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.18
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase
    Species: Zea mays [TaxId:4577]
    Gene: CHIA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6JBL3 (5-200)
      • expression tag (0-4)
      • see remark 999 (7)
      • engineered mutation (66)
    Domains in SCOPe 2.08: d4mcka1, d4mcka2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4mckA (A:)
xxxxxvvsdaffngiknqagsgcegknfytrsaflsavnaypgfahggtevegkreiaaf
fahvthqtghfcyiseinksnaycdasnrwpcaagqkyygrgplqiswnynygpagrdig
fngladpnrvaqdaviafktalwfwmnnvhrlmpqgfgatirainglecngnnpaqmnar
vgyykqycqqlrvdpgpnltc