PDB entry 4mcd

View 4mcd on RCSB PDB site
Description: hinTrmD in complex with 5-PHENYLTHIENO[2,3-D]PYRIMIDIN-4(3H)-ONE
Class: transferase/transferase inhibitor
Keywords: trefoil, TrmD, SAM, SAH, Sinefungin, HMT, Structural Genomics, transferase-transferase inhibitor complex
Deposited on 2013-08-21, released 2013-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.207
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA (guanine-N(1)-)-methyltransferase
    Species: Haemophilus influenzae Rd KW20 [TaxId:71421]
    Gene: HI_0202, trmD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mcda_
  • Heterogens: 22L, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mcdA (A:)
    mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm
    lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide
    rliqteideewsigdyvltggelpamtlidavarfipgvlgkqasaeedsfadglldcph
    ytrpevlegltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkea
    qaehns
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mcdA (A:)
    mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm
    lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide
    rliqteideewsigdyvltggelpamtlidavarfipgvlsfadglldcphytrpevleg
    ltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkeaqaehns