PDB entry 4mcb

View 4mcb on RCSB PDB site
Description: H.influenzae TrmD in complex with N-(4-{[(1H-IMIDAZOL-2-YLMETHYL)AMINO]METHYL}BENZYL)-4-OXO-3,4-DIHYDROTHIENO[2,3-D]PYRIMIDINE-5-CARBOXAMIDE
Class: transferase/transferase inhibitor
Keywords: trefoil, TrmD, SAM, SAH, Sinefungin, HMT, Structural Genomics, trefoil knot, methyl transferase to tRNA, tRNA, transferase-transferase inhibitor complex
Deposited on 2013-08-21, released 2013-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.18
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA (guanine-N(1)-)-methyltransferase
    Species: Haemophilus influenzae [TaxId:71421]
    Gene: HI_0202, trmD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mcba_
  • Chain 'B':
    Compound: tRNA (guanine-N(1)-)-methyltransferase
    Species: Haemophilus influenzae [TaxId:71421]
    Gene: HI_0202, trmD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mcbb_
  • Heterogens: GOL, SO4, 21W, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mcbA (A:)
    mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm
    lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide
    rliqteideewsigdyvltggelpamtlidavarfipgvlgkqasaeedsfadglldcph
    ytrpevlegltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkea
    qaehns
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mcbA (A:)
    mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm
    lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide
    rliqteideewsigdyvltggelpamtlidavarfipgvlglldcphytrpevlegltvp
    pvlmshheeirkwrlkqslqrtwlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mcbB (B:)
    mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm
    lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide
    rliqteideewsigdyvltggelpamtlidavarfipgvlgkqasaeedsfadglldcph
    ytrpevlegltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkea
    qaehns
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mcbB (B:)
    mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm
    lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide
    rliqteideewsigdyvltggelpamtlidavarfipgvlgkqasaeedsfadglldcph
    ytrpevlegltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkea
    qae