PDB entry 4mc7

View 4mc7 on RCSB PDB site
Description: Crystal structure of a subtype N11 neuraminidase-like protein of A/flat-faced bat/Peru/033/2010 (H18N11)
Class: viral protein
Keywords: bat, influenza, VIRAL PROTEIN
Deposited on 2013-08-21, released 2013-10-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.217
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4MC7
    Domains in SCOPe 2.05: d4mc7a_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4MC7
    Domains in SCOPe 2.05: d4mc7b_
  • Chain 'C':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4MC7
    Domains in SCOPe 2.05: d4mc7c_
  • Chain 'D':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4MC7
    Domains in SCOPe 2.05: d4mc7d_
  • Heterogens: NAG, CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mc7A (A:)
    gsgdsgspgiatplvlgenlcsingwvptyrgegttgkipdeqmltrqnfvscsdkecrr
    ffvsmgygtttnfadlivseqmnvysvklgdpptpdklkfeavgwsasschdgfqwtvls
    vagdgfvsilyggiitdtihptnggplrtqasscicndgtcytiiadgttytasshrlyr
    lvngtsagwkaldttgfnfefptcyytsgkvkctgtnlwndakrpflefdqsftytfkep
    clgflgdtprgidttnycdktttegeggiqgfmiegsnswigriinpgskkgfeiykflg
    tlfsvqtvgnrnyqllsnstigrsglyqpayesrdcqelcfwieiaattkaglssndlit
    fcgtggsmpdvnwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mc7A (A:)
    atplvlgenlcsingwvptyrgegttgkipdeqmltrqnfvscsdkecrrffvsmgygtt
    tnfadlivseqmnvysvklgdpptpdklkfeavgwsasschdgfqwtvlsvagdgfvsil
    yggiitdtihptnggplrtqasscicndgtcytiiadgttytasshrlyrlvngtsagwk
    aldttgfnfefptcyytsgkvkctgtnlwndakrpflefdqsftytfkepclgflgdtpr
    gidttnycdktttegeggiqgfmiegsnswigriinpgskkgfeiykflgtlfsvqtvgn
    rnyqllsnstigrsglyqpayesrdcqelcfwieiaattkaglssndlitfcgtggsmpd
    vnw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mc7B (B:)
    gsgdsgspgiatplvlgenlcsingwvptyrgegttgkipdeqmltrqnfvscsdkecrr
    ffvsmgygtttnfadlivseqmnvysvklgdpptpdklkfeavgwsasschdgfqwtvls
    vagdgfvsilyggiitdtihptnggplrtqasscicndgtcytiiadgttytasshrlyr
    lvngtsagwkaldttgfnfefptcyytsgkvkctgtnlwndakrpflefdqsftytfkep
    clgflgdtprgidttnycdktttegeggiqgfmiegsnswigriinpgskkgfeiykflg
    tlfsvqtvgnrnyqllsnstigrsglyqpayesrdcqelcfwieiaattkaglssndlit
    fcgtggsmpdvnwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mc7B (B:)
    atplvlgenlcsingwvptyrgegttgkipdeqmltrqnfvscsdkecrrffvsmgygtt
    tnfadlivseqmnvysvklgdpptpdklkfeavgwsasschdgfqwtvlsvagdgfvsil
    yggiitdtihptnggplrtqasscicndgtcytiiadgttytasshrlyrlvngtsagwk
    aldttgfnfefptcyytsgkvkctgtnlwndakrpflefdqsftytfkepclgflgdtpr
    gidttnycdktttegeggiqgfmiegsnswigriinpgskkgfeiykflgtlfsvqtvgn
    rnyqllsnstigrsglyqpayesrdcqelcfwieiaattkaglssndlitfcgtggsmpd
    vnw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4mc7C (C:)
    gsgdsgspgiatplvlgenlcsingwvptyrgegttgkipdeqmltrqnfvscsdkecrr
    ffvsmgygtttnfadlivseqmnvysvklgdpptpdklkfeavgwsasschdgfqwtvls
    vagdgfvsilyggiitdtihptnggplrtqasscicndgtcytiiadgttytasshrlyr
    lvngtsagwkaldttgfnfefptcyytsgkvkctgtnlwndakrpflefdqsftytfkep
    clgflgdtprgidttnycdktttegeggiqgfmiegsnswigriinpgskkgfeiykflg
    tlfsvqtvgnrnyqllsnstigrsglyqpayesrdcqelcfwieiaattkaglssndlit
    fcgtggsmpdvnwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mc7C (C:)
    atplvlgenlcsingwvptyrgegttgkipdeqmltrqnfvscsdkecrrffvsmgygtt
    tnfadlivseqmnvysvklgdpptpdklkfeavgwsasschdgfqwtvlsvagdgfvsil
    yggiitdtihptnggplrtqasscicndgtcytiiadgttytasshrlyrlvngtsagwk
    aldttgfnfefptcyytsgkvkctgtnlwndakrpflefdqsftytfkepclgflgdtpr
    gidttnycdktttegeggiqgfmiegsnswigriinpgskkgfeiykflgtlfsvqtvgn
    rnyqllsnstigrsglyqpayesrdcqelcfwieiaattkaglssndlitfcgtggsmpd
    vnw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4mc7D (D:)
    gsgdsgspgiatplvlgenlcsingwvptyrgegttgkipdeqmltrqnfvscsdkecrr
    ffvsmgygtttnfadlivseqmnvysvklgdpptpdklkfeavgwsasschdgfqwtvls
    vagdgfvsilyggiitdtihptnggplrtqasscicndgtcytiiadgttytasshrlyr
    lvngtsagwkaldttgfnfefptcyytsgkvkctgtnlwndakrpflefdqsftytfkep
    clgflgdtprgidttnycdktttegeggiqgfmiegsnswigriinpgskkgfeiykflg
    tlfsvqtvgnrnyqllsnstigrsglyqpayesrdcqelcfwieiaattkaglssndlit
    fcgtggsmpdvnwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mc7D (D:)
    atplvlgenlcsingwvptyrgegttgkipdeqmltrqnfvscsdkecrrffvsmgygtt
    tnfadlivseqmnvysvklgdpptpdklkfeavgwsasschdgfqwtvlsvagdgfvsil
    yggiitdtihptnggplrtqasscicndgtcytiiadgttytasshrlyrlvngtsagwk
    aldttgfnfefptcyytsgkvkctgtnlwndakrpflefdqsftytfkepclgflgdtpr
    gidttnycdktttegeggiqgfmiegsnswigriinpgskkgfeiykflgtlfsvqtvgn
    rnyqllsnstigrsglyqpayesrdcqelcfwieiaattkaglssndlitfcgtggsmpd
    vnw