PDB entry 4mc5

View 4mc5 on RCSB PDB site
Description: Crystal structure of a subtype H18 hemagglutinin homologue from A/flat-faced bat/Peru/033/2010 (H18N11)
Class: viral protein
Keywords: bat, influenza, VIRAL PROTEIN
Deposited on 2013-08-21, released 2013-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.176
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4MC5
    Domains in SCOPe 2.07: d4mc5a1, d4mc5a2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4MC5
    Domains in SCOPe 2.07: d4mc5b1, d4mc5b2
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4MC5
    Domains in SCOPe 2.07: d4mc5c1, d4mc5c2, d4mc5c3
  • Heterogens: FUC, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mc5A (A:)
    adpgdqicigyhsnnstqtvntllesnvpvtsshsilekehngllcklkgkapldlidcs
    lpawlmgnpkcdelltasewayikedpepengicfpgdfdsledlillvsntdhfrkeki
    idmtrfsdvttnnvdsacpydtngasfyrnlnwvqqnkgkqlifhyqnsennplliiwgv
    hqtsnaaeqntyygsqtgsttitigeetntyplvisessilnghsdrinyfwgvvnpnqn
    fsivstgnfiwpeygyffqkttnisgiikssekisdcdticqtkigainstlpfqnihqn
    aigdcpkyvkaqelvlatglrnnpiketrglfgaiagfieggwqglidgwygyhhqnseg
    sgyaadkeatqkavdaittkvnniidkmntqfestakefnkiemrikhlsdrvddgfldv
    wsynaellvllenertldfhdanvnnlyqkvkvqlkdnaidmgngcfkilhkcnntcmdd
    ikngtynyyeyrkeshlekqkidsgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mc5A (A:)
    gdqicigyhsnnstqtvntllesnvpvtsshsilekehngllcklkgkapldlidcslpa
    wlmgnpkcdelltasewayikedpepengicfpgdfdsledlillvsntdhfrkekiidm
    trfsdvttnnvdsacpydtngasfyrnlnwvqqnkgkqlifhyqnsennplliiwgvhqt
    snaaeqntyygsqtgsttitigeetntyplvisessilnghsdrinyfwgvvnpnqnfsi
    vstgnfiwpeygyffqkttnisgiikssekisdcdticqtkigainstlpfqnihqnaig
    dcpkyvkaqelvlatglrnnpiaiagfieggwqglidgwygyhhqnsegsgyaadkeatq
    kavdaittkvnniidkmntqfestakefnkiemrikhlsdrvddgfldvwsynaellvll
    enertldfhdanvnnlyqkvkvqlkdnaidmgngcfkilhkcnntcmddikngtynyyey
    rkeshlekqkidsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mc5B (B:)
    adpgdqicigyhsnnstqtvntllesnvpvtsshsilekehngllcklkgkapldlidcs
    lpawlmgnpkcdelltasewayikedpepengicfpgdfdsledlillvsntdhfrkeki
    idmtrfsdvttnnvdsacpydtngasfyrnlnwvqqnkgkqlifhyqnsennplliiwgv
    hqtsnaaeqntyygsqtgsttitigeetntyplvisessilnghsdrinyfwgvvnpnqn
    fsivstgnfiwpeygyffqkttnisgiikssekisdcdticqtkigainstlpfqnihqn
    aigdcpkyvkaqelvlatglrnnpiketrglfgaiagfieggwqglidgwygyhhqnseg
    sgyaadkeatqkavdaittkvnniidkmntqfestakefnkiemrikhlsdrvddgfldv
    wsynaellvllenertldfhdanvnnlyqkvkvqlkdnaidmgngcfkilhkcnntcmdd
    ikngtynyyeyrkeshlekqkidsgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mc5B (B:)
    gdqicigyhsnnstqtvntllesnvpvtsshsilekehngllcklkgkapldlidcslpa
    wlmgnpkcdelltasewayikedpepengicfpgdfdsledlillvsntdhfrkekiidm
    trfsdvttnnvdsacpydtngasfyrnlnwvqqnkgkqlifhyqnsennplliiwgvhqt
    snaaeqntyygsqtgsttitigeetntyplvisessilnghsdrinyfwgvvnpnqnfsi
    vstgnfiwpeygyffqkttnisgiikssekisdcdticqtkigainstlpfqnihqnaig
    dcpkyvkaqelvlatglrnnpiaiagfieggwqglidgwygyhhqnsegsgyaadkeatq
    kavdaittkvnniidkmntqfestakefnkiemrikhlsdrvddgfldvwsynaellvll
    enertldfhdanvnnlyqkvkvqlkdnaidmgngcfkilhkcnntcmddikngtynyyey
    rkeshlekqkidsg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4mc5C (C:)
    adpgdqicigyhsnnstqtvntllesnvpvtsshsilekehngllcklkgkapldlidcs
    lpawlmgnpkcdelltasewayikedpepengicfpgdfdsledlillvsntdhfrkeki
    idmtrfsdvttnnvdsacpydtngasfyrnlnwvqqnkgkqlifhyqnsennplliiwgv
    hqtsnaaeqntyygsqtgsttitigeetntyplvisessilnghsdrinyfwgvvnpnqn
    fsivstgnfiwpeygyffqkttnisgiikssekisdcdticqtkigainstlpfqnihqn
    aigdcpkyvkaqelvlatglrnnpiketrglfgaiagfieggwqglidgwygyhhqnseg
    sgyaadkeatqkavdaittkvnniidkmntqfestakefnkiemrikhlsdrvddgfldv
    wsynaellvllenertldfhdanvnnlyqkvkvqlkdnaidmgngcfkilhkcnntcmdd
    ikngtynyyeyrkeshlekqkidsgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mc5C (C:)
    gdqicigyhsnnstqtvntllesnvpvtsshsilekehngllcklkgkapldlidcslpa
    wlmgnpkcdelltasewayikedpepengicfpgdfdsledlillvsntdhfrkekiidm
    trfsdvttnnvdsacpydtngasfyrnlnwvqqnkgkqlifhyqnsennplliiwgvhqt
    snaaeqntyygsqtgsttitigeetntyplvisessilnghsdrinyfwgvvnpnqnfsi
    vstgnfiwpeygyffqkttnisgiikssekisdcdticqtkigainstlpfqnihqnaig
    dcpkyvkaqelvlatglrnnpikfgaiagfieggwqglidgwygyhhqnsegsgyaadke
    atqkavdaittkvnniidkmntqfestakefnkiemrikhlsdrvddgfldvwsynaell
    vllenertldfhdanvnnlyqkvkvqlkdnaidmgngcfkilhkcnntcmddikngtyny
    yeyrkeshlekqkidsg