PDB entry 4mbx

View 4mbx on RCSB PDB site
Description: Structure of unliganded B-Lymphotropic Polyomavirus VP1
Class: viral protein
Keywords: jelly roll, polyomavirus, viral capsid (structural) protein, DNA encapsidation, receptor binding, Sialylated oligosaccharides, Viral Coat Protein, VIRAL PROTEIN
Deposited on 2013-08-21, released 2013-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.167
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major capsid protein VP1
    Species: B-lymphotropic polyomavirus [TaxId:332091]
    Gene: VP1
    Database cross-references and differences (RAF-indexed):
    • PDB 4MBX (Start-277)
    Domains in SCOPe 2.07: d4mbxa_
  • Chain 'B':
    Compound: Major capsid protein VP1
    Species: B-lymphotropic polyomavirus [TaxId:332091]
    Gene: VP1
    Database cross-references and differences (RAF-indexed):
    • PDB 4MBX
    Domains in SCOPe 2.07: d4mbxb_
  • Chain 'C':
    Compound: Major capsid protein VP1
    Species: B-lymphotropic polyomavirus [TaxId:332091]
    Gene: VP1
    Database cross-references and differences (RAF-indexed):
    • PDB 4MBX
    Domains in SCOPe 2.07: d4mbxc_
  • Chain 'D':
    Compound: Major capsid protein VP1
    Species: B-lymphotropic polyomavirus [TaxId:332091]
    Gene: VP1
    Database cross-references and differences (RAF-indexed):
    • PDB 4MBX
    Domains in SCOPe 2.07: d4mbxd_
  • Chain 'E':
    Compound: Major capsid protein VP1
    Species: B-lymphotropic polyomavirus [TaxId:332091]
    Gene: VP1
    Database cross-references and differences (RAF-indexed):
    • PDB 4MBX (Start-277)
    Domains in SCOPe 2.07: d4mbxe_
  • Chain 'F':
    Compound: Major capsid protein VP1
    Species: B-lymphotropic polyomavirus [TaxId:332091]
    Gene: VP1
    Database cross-references and differences (RAF-indexed):
    • PDB 4MBX
    Domains in SCOPe 2.07: d4mbxf_
  • Chain 'G':
    Compound: Major capsid protein VP1
    Species: B-lymphotropic polyomavirus [TaxId:332091]
    Gene: VP1
    Database cross-references and differences (RAF-indexed):
    • PDB 4MBX
    Domains in SCOPe 2.07: d4mbxg_
  • Chain 'H':
    Compound: Major capsid protein VP1
    Species: B-lymphotropic polyomavirus [TaxId:332091]
    Gene: VP1
    Database cross-references and differences (RAF-indexed):
    • PDB 4MBX
    Domains in SCOPe 2.07: d4mbxh_
  • Chain 'I':
    Compound: Major capsid protein VP1
    Species: B-lymphotropic polyomavirus [TaxId:332091]
    Gene: VP1
    Database cross-references and differences (RAF-indexed):
    • PDB 4MBX
    Domains in SCOPe 2.07: d4mbxi_
  • Chain 'J':
    Compound: Major capsid protein VP1
    Species: B-lymphotropic polyomavirus [TaxId:332091]
    Gene: VP1
    Database cross-references and differences (RAF-indexed):
    • PDB 4MBX
    Domains in SCOPe 2.07: d4mbxj_
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mbxA (A:)
    gshmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkd
    tlpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcv
    pvqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgk
    ypvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    cadiagvhtnysetqvwrglpryfnvtlrkrivknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mbxA (A:)
    shmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkdt
    lpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcvp
    vqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgky
    pvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsc
    adiagvhtnysetqvwrglpryfnvtlrkrivknpyp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mbxB (B:)
    gshmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkd
    tlpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcv
    pvqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgk
    ypvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    cadiagvhtnysetqvwrglpryfnvtlrkrivknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mbxB (B:)
    shmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkdt
    lpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcvp
    vqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgky
    pvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsc
    adiagvhtnysetqvwrglpryfnvtlrkrivknpy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4mbxC (C:)
    gshmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkd
    tlpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcv
    pvqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgk
    ypvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    cadiagvhtnysetqvwrglpryfnvtlrkrivknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mbxC (C:)
    shmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkdt
    lpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcvp
    vqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgky
    pvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsc
    adiagvhtnysetqvwrglpryfnvtlrkrivknpy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4mbxD (D:)
    gshmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkd
    tlpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcv
    pvqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgk
    ypvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    cadiagvhtnysetqvwrglpryfnvtlrkrivknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mbxD (D:)
    shmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkdt
    lpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcvp
    vqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgky
    pvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsc
    adiagvhtnysetqvwrglpryfnvtlrkrivknp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4mbxE (E:)
    gshmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkd
    tlpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcv
    pvqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgk
    ypvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    cadiagvhtnysetqvwrglpryfnvtlrkrivknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mbxE (E:)
    shmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkdt
    lpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcvp
    vqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgky
    pvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsc
    adiagvhtnysetqvwrglpryfnvtlrkrivknpyp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4mbxF (F:)
    gshmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkd
    tlpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcv
    pvqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgk
    ypvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    cadiagvhtnysetqvwrglpryfnvtlrkrivknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mbxF (F:)
    shmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkdt
    lpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcvp
    vqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgky
    pvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsc
    adiagvhtnysetqvwrglpryfnvtlrkrivkn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4mbxG (G:)
    gshmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkd
    tlpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcv
    pvqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgk
    ypvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    cadiagvhtnysetqvwrglpryfnvtlrkrivknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mbxG (G:)
    shmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkdt
    lpcysvaviklpllmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcvpvqg
    ttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgkypve
    vwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflscadi
    agvhtnysetqvwrglpryfnvtlrkrivk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4mbxH (H:)
    gshmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkd
    tlpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcv
    pvqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgk
    ypvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    cadiagvhtnysetqvwrglpryfnvtlrkrivknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mbxH (H:)
    shmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkdt
    lpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcvp
    vqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgky
    pvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsc
    adiagvhtnysetqvwrglpryfnvtlrkrivkn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4mbxI (I:)
    gshmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkd
    tlpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcv
    pvqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgk
    ypvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    cadiagvhtnysetqvwrglpryfnvtlrkrivknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mbxI (I:)
    shmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkdt
    lpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcvp
    vqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgky
    pvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsc
    adiagvhtnysetqvwrglpryfnvtlrkrivknp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4mbxJ (J:)
    gshmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkd
    tlpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcv
    pvqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgk
    ypvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklfls
    cadiagvhtnysetqvwrglpryfnvtlrkrivknpyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mbxJ (J:)
    shmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkdt
    lpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcvp
    vqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgky
    pvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsc
    adiagvhtnysetqvwrglpryfnvtlrkrivknpy