PDB entry 4mbr

View 4mbr on RCSB PDB site
Description: 3.65 angstrom crystal structure of serine-rich repeat protein (srr2) from streptococcus agalactiae
Deposited on 2013-08-19, released 2013-11-06
The last revision was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 3.65 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine-rich repeat protein 2
    Species: STREPTOCOCCUS AGALACTIAE [TaxId:1311]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4mbrA (A:)
    metlpaalisgegdvttvqgqdvtdklqnldiklsggvqakagvinmdksesmhmslkft
    idsvnrgdtfeiklsdnidtngasnysivepiksptgevyatgiydsqkksivysftdfa
    asknningildiplwpddttvqntkedvlfsvkikdqeatiketvkydppvridfaggvs
    vdsritniddvgkkmtyisqinvdgkslynynglytriynyskestadlknstikiyktt
    sdnivesmvqdyssmedvtskfansypekgwydiywgqfiasnetyvivvetpftnavtl
    nttlsdynenngvehnhtyssesgysdvnaqerkillehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >4mbrA (A:)
    vqgqdvtdklqnldiklsggvqakagvinmdksesmhmslkftidsvnrgdtfeiklsdn
    idtngasnysivepiksptgevyatgiydsqkksivysftdfaasknningildiplwpd
    dttvqntkedvlfsvkikdqeatiketvkydppvridfaggvsvdsritniddvgkkmty
    isqinvdgkslynynglytriynyskestadlknstikiykttsdnivesmvqdyssmed
    vtskfansypekgwydiywgqfiasnetyvivvetpftnavtlnttlsdynenngvehnh
    tyssesgysdvnaqer