PDB entry 4mb7

View 4mb7 on RCSB PDB site
Description: Crystal Structure of a viral DNA glycosylase
Deposited on 2013-08-19, released 2013-10-30
The last revision was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.19
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endonuclease 8-like L720
    Species: Acanthamoeba polyphaga mimivirus [TaxId:212035]
    Gene: Endonuclease VIII (nei) 2, MIMI_L720
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4mb7A (A:)
veaprirityekirhtknhrivsisgpsykrmnvdlidyiirkwwfagkyiylmlissnk
ptyvirthmmmhgrilvgnqdsptkrafmiiqldndivlrwyrsqitlldpnclaeiktn
yticttrqaimdsiklmkydlsnnrfdynlfqshlknginihsseiitdflldqeyfpgv
gnilqqealydckilplkkvqdidepmfdclcnslkkiidllyesykfresgkefgpilr
iyrkslcplghktirkkiglrnrmttwcpvcql