PDB entry 4mb1

View 4mb1 on RCSB PDB site
Description: The Structure of MalL mutant enzyme G202P from Bacillus subtilus
Class: hydrolase
Keywords: TIM barrel, alpha glucosidase, HYDROLASE
Deposited on 2013-08-19, released 2013-09-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.174
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oligo-1,6-glucosidase 1
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: malL, yvdL, BSU34560
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06994 (Start-560)
      • engineered mutation (201)
    Domains in SCOPe 2.06: d4mb1a1, d4mb1a2
  • Heterogens: TRS, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mb1A (A:)
    msewwkeavvyqiyprsfydangdgfgdlqgviqkldyiknlgadviwlspvfdspqddn
    gydisdyknmyekfgtnedmfqlidevhkrgmkivmdlvvnhtsdehawfaesrkskdnp
    yrdyylwkdpkpdgsepnnwgsifsgsawtydegtgqyylhyfskkqpdlnweneavrre
    vydvmrfwmdrgvdgwrmdvipsiskytdfpdyetdhsrsyivgryhsngprlhefiqem
    nrevlshydcmtvgeangsdieeakkytdasrqelnmiftfehmdidkeqnspngkwqik
    pfdlialkktmtrwqtglmnvgwntlyfenhdqprvisrwgndrklrkecakafatvlhg
    mkgtpfiyqgeeigmvnsdmplemyddleiknayrelvvenktmsekefvkavmikgrdh
    artpmqwdagkhagftagdpwipvnsryqdinvkesledqdsiffyyqkliqlrkqykim
    iygdyqllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnypq
    eradlksislkpyeavmgisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mb1A (A:)
    ewwkeavvyqiyprsfydangdgfgdlqgviqkldyiknlgadviwlspvfdspqddngy
    disdyknmyekfgtnedmfqlidevhkrgmkivmdlvvnhtsdehawfaesrkskdnpyr
    dyylwkdpkpdgsepnnwgsifsgsawtydegtgqyylhyfskkqpdlnweneavrrevy
    dvmrfwmdrgvdgwrmdvipsiskytdfpdyetdhsrsyivgryhsngprlhefiqemnr
    evlshydcmtvgeangsdieeakkytdasrqelnmiftfehmdidkeqnspngkwqikpf
    dlialkktmtrwqtglmnvgwntlyfenhdqprvisrwgndrklrkecakafatvlhgmk
    gtpfiyqgeeigmvnsdmplemyddleiknayrelvvenktmsekefvkavmikgrdhar
    tpmqwdagkhagftagdpwipvnsryqdinvkesledqdsiffyyqkliqlrkqykimiy
    gdyqllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnypqad
    lksislkpyeavmgisi