PDB entry 4mao

View 4mao on RCSB PDB site
Description: RSK2 T493M C-Terminal Kinase Domain in Complex with RMM58
Class: transferase/transferase inhibitor
Keywords: Protein Kinase, Phosphorylation, Covalent Inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-08-16, released 2014-10-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.238
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal protein S6 kinase alpha-3
    Species: Mus musculus [TaxId:10090]
    Gene: Rps6ka3, Mapkapk1b, Rps6ka-rs1, Rsk2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18654
      • engineered mutation (107)
      • engineered mutation (205)
    Domains in SCOPe 2.06: d4maoa_
  • Heterogens: 28D, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4maoA (A:)
    ahhhhhhvddddkmqtvgvhsivqqlhrnsiqftdgyevkedigvgsysvckrcihkatn
    mefavkiidkskrdpteeieillrygqhpniitlkdvyddgkyvyvvmelmkggelldki
    lrqkffsereasavlftitktveylhaqgvvhrdlkpsnilyvdesgnpesiricdfgfa
    kqlraengllmtpcytanfvapevlerqgydaacdiwslgvllytmltgytpfangpddt
    peeilarigsgkfslsggywnsvsdtakdlvskmlhvdphqrltaalvlrhpwivhwdql
    pqyqlnrqdaphlvkgamaatysalnrnqspvlepvgrstlaqrrgikkitstal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4maoA (A:)
    siqftdgyevkedigvgsysvckrcihkatnmefavkiidkskrdpteeieillrygqhp
    niitlkdvyddgkyvyvvmelmkggelldkilrqkffsereasavlftitktveylhaqg
    vvhrdlkpsnilyvdesgnpesiricdfgfakqlraengllmtpcytanfvapevlerqg
    ydaacdiwslgvllytmltgytpfangpddtpeeilarigsgkfslsggywnsvsdtakd
    lvskmlhvdphqrltaalvlrhpwivhwdqlpqyqlnrqdaphlvkgamaatysalnr