PDB entry 4mac

View 4mac on RCSB PDB site
Description: Crystal structure of CIDE-N domain of FSP27
Class: apoptosis
Keywords: roll fold, Protein interaction, Perilipin1, APOPTOSIS
Deposited on 2013-08-16, released 2014-07-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell death activator CIDE-3
    Species: Mus musculus [TaxId:10090]
    Gene: Cidec, Fsp27
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4maca_
  • Chain 'B':
    Compound: Cell death activator CIDE-3
    Species: Mus musculus [TaxId:10090]
    Gene: Cidec, Fsp27
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4macb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4macA (A:)
    vskpsretprarpcrvstadrkvrkgimahsledllnkvqdilklkdkpfslvleedgti
    veteeyfqalakdtmfmvllkgqkwkppslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4macA (A:)
    etprarpcrvstadrkvrkgimahsledllnkvqdilklkdkpfslvleedgtiveteey
    fqalakdtmfmvllkgqkwkpp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4macB (B:)
    vskpsretprarpcrvstadrkvrkgimahsledllnkvqdilklkdkpfslvleedgti
    veteeyfqalakdtmfmvllkgqkwkppslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4macB (B:)
    arpcrvstadrkvrkgimahsledllnkvqdilklkdkpfslvleedgtiveteeyfqal
    akdtmfmvllkgqkwkpp