PDB entry 4mab

View 4mab on RCSB PDB site
Description: Resolving Cys to Ala variant of Salmonella Alkyl Hydroperoxide Reductase C in its substrate-ready conformation
Class: oxidoreductase
Keywords: thioredoxin fold, Prx1, Prx, resolving Cys mutant, peroxidase, peroxiredoxin, OXIDOREDUCTASE
Deposited on 2013-08-15, released 2013-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: ahpC, ahpC STM0608, STM0608
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A251 (0-End)
      • engineered mutation (164)
    Domains in SCOPe 2.06: d4maba_
  • Chain 'B':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: ahpC, ahpC STM0608, STM0608
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A251 (0-185)
      • engineered mutation (164)
    Domains in SCOPe 2.06: d4mabb_
  • Chain 'C':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: ahpC, ahpC STM0608, STM0608
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A251 (0-185)
      • engineered mutation (164)
    Domains in SCOPe 2.06: d4mabc_
  • Chain 'D':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: ahpC, ahpC STM0608, STM0608
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A251 (0-185)
      • engineered mutation (164)
    Domains in SCOPe 2.06: d4mabd_
  • Chain 'E':
    Compound: Alkyl hydroperoxide reductase subunit C
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: ahpC, ahpC STM0608, STM0608
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A251 (0-185)
      • engineered mutation (164)
    Domains in SCOPe 2.06: d4mabe_
  • Heterogens: K, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mabA (A:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevapakwkegeatlapsl
    dlvgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mabA (A:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgeva
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mabB (B:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevapakwkegeatlapsl
    dlvgki
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mabC (C:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevapakwkegeatlapsl
    dlvgki
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mabD (D:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevapakwkegeatlapsl
    dlvgki
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mabE (E:)
    slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
    qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
    tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevapakwkegeatlapsl
    dlvgki