PDB entry 4ma1

View 4ma1 on RCSB PDB site
Description: Unliganded 3 crystal structure of S25-26 Fab
Class: immune system
Keywords: Carbohydrate/Sugar Binding, IMMUNE SYSTEM
Deposited on 2013-08-15, released 2014-04-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: S25-26 Fab (Igg1k) Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4MA1 (0-End)
  • Chain 'C':
    Compound: S25-26 Fab (Igg1k) Light Chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4MA1 (0-218)
    Domains in SCOPe 2.07: d4ma1c1, d4ma1c2
  • Chain 'E':
    Compound: S25-26 Fab (Igg1k) Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4MA1 (Start-218)
  • Chain 'F':
    Compound: S25-26 Fab (Igg1k) Light Chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4MA1 (0-218)
    Domains in SCOPe 2.07: d4ma1f1, d4ma1f2
  • Chain 'H':
    Compound: S25-26 Fab (Igg1k) Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4MA1 (0-End)
  • Chain 'L':
    Compound: S25-26 Fab (Igg1k) Light Chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4MA1 (0-218)
    Domains in SCOPe 2.07: d4ma1l1, d4ma1l2
  • Heterogens: NAG, FUC, BMA, MAN, PEG, GAL, GLA, K, HOH

PDB Chain Sequences:

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ma1C (C:)
    dilmnqtplslpvslgdqasiscrssqyivhrngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ma1F (F:)
    dilmnqtplslpvslgdqasiscrssqyivhrngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ma1L (L:)
    dilmnqtplslpvslgdqasiscrssqyivhrngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec