PDB entry 4m9w

View 4m9w on RCSB PDB site
Description: Crystal Structure of Ara h 8 with MES bound
Class: plant protein
Keywords: Bet v 1 like, Small Molecule Carrier, PLANT PROTEIN
Deposited on 2013-08-15, released 2013-11-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.208
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ara h 8 allergen
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m9wa_
  • Chain 'B':
    Compound: Ara h 8 allergen
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m9wb_
  • Heterogens: NA, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m9wA (A:)
    mgvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltived
    getkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyh
    tkgdakpdeeelkkgkakgeglfraiegyvlanptqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m9wA (A:)
    gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
    etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
    kgdakpdeeelkkgkakgeglfraiegyvlanptqy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m9wB (B:)
    mgvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltived
    getkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyh
    tkgdakpdeeelkkgkakgeglfraiegyvlanptqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m9wB (B:)
    gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
    etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
    kgdakpdeeelkkgkakgeglfraiegyvlanptqy