PDB entry 4m9o

View 4m9o on RCSB PDB site
Description: Crystal Structure of monomeric zebrafish beta-2-microglobulin
Class: Immune system
Keywords: complex partner of MHC class I, beta-2-microglobulin family, Ig-like C1-type (immunoglobulin-like) domain. Heterodimer, Immune system
Deposited on 2013-08-15, released 2014-09-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.175
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin
    Species: Danio rerio [TaxId:7955]
    Gene: B2M, beta-2-microglobulin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4m9oa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m9oA (A:)
    mgkvstpkvhvyshfpgeygkpntlicyvssfhppdisiellkngqvmsdtkqtdlafek
    gwqfhltksvaftpekgdeytcsvrhmketkkfswepnmlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m9oA (A:)
    kvstpkvhvyshfpgeygkpntlicyvssfhppdisiellkngqvmsdtkqtdlafekgw
    qfhltksvaftpekgdeytcsvrhmketkkfswepnm