PDB entry 4m9c

View 4m9c on RCSB PDB site
Description: WeeI from Acinetobacter baumannii AYE
Class: transferase
Keywords: left-handed beta-helix, rossmann fold, acetyltransferase, Transferase
Deposited on 2013-08-14, released 2013-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacterial transferase hexapeptide (Three repeats) family protein
    Species: Acinetobacter baumannii [TaxId:470]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m9ca_
  • Chain 'B':
    Compound: Bacterial transferase hexapeptide (Three repeats) family protein
    Species: Acinetobacter baumannii [TaxId:470]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m9cb_
  • Chain 'C':
    Compound: Bacterial transferase hexapeptide (Three repeats) family protein
    Species: Acinetobacter baumannii [TaxId:470]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m9cc_
  • Chain 'D':
    Compound: Bacterial transferase hexapeptide (Three repeats) family protein
    Species: Acinetobacter baumannii [TaxId:470]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m9cd_
  • Chain 'E':
    Compound: Bacterial transferase hexapeptide (Three repeats) family protein
    Species: Acinetobacter baumannii [TaxId:470]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m9ce_
  • Chain 'F':
    Compound: Bacterial transferase hexapeptide (Three repeats) family protein
    Species: Acinetobacter baumannii [TaxId:470]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m9cf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4m9cA (A:)
    mtmiigvygasgfgkevmplvrqqfptlskeqfafiddglsgttlngypvlsyldfiskp
    adhkavtiaiansvvreklvsllekdgvqhlavqstntvildeveigegsllcpftclts
    nikigkffhaniysyvahdcvigdyvtfapgakcngnihiedhayigtgavikqgtpdkp
    liigkgaivgmgavvtksvpagvtvvgnparilerk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m9cB (B:)
    mtmiigvygasgfgkevmplvrqqfptlskeqfafiddglsgttlngypvlsyldfiskp
    adhkavtiaiansvvreklvsllekdgvqhlavqstntvildeveigegsllcpftclts
    nikigkffhaniysyvahdcvigdyvtfapgakcngnihiedhayigtgavikqgtpdkp
    liigkgaivgmgavvtksvpagvtvvgnparilerk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m9cB (B:)
    mtmiigvygasgfgkevmplvrqqfptlskeqfafiddglsgttlngypvlsyldfiskp
    adhkavtiaiansvvreklvsllekdgvqhlavqstntvildeveigegsllcpftclts
    nikigkffhaniysyvahdcvigdyvtfapgakcngnihiedhayigtgavikqgtpdkp
    liigkgaivgmgavvtksvpagvtvvgnparil
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4m9cC (C:)
    mtmiigvygasgfgkevmplvrqqfptlskeqfafiddglsgttlngypvlsyldfiskp
    adhkavtiaiansvvreklvsllekdgvqhlavqstntvildeveigegsllcpftclts
    nikigkffhaniysyvahdcvigdyvtfapgakcngnihiedhayigtgavikqgtpdkp
    liigkgaivgmgavvtksvpagvtvvgnparilerk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4m9cD (D:)
    mtmiigvygasgfgkevmplvrqqfptlskeqfafiddglsgttlngypvlsyldfiskp
    adhkavtiaiansvvreklvsllekdgvqhlavqstntvildeveigegsllcpftclts
    nikigkffhaniysyvahdcvigdyvtfapgakcngnihiedhayigtgavikqgtpdkp
    liigkgaivgmgavvtksvpagvtvvgnparilerk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m9cD (D:)
    mtmiigvygasgfgkevmplvrqqfptlskeqfafiddglsgttlngypvlsyldfiskp
    adhkavtiaiansvvreklvsllekdgvqhlavqstntvildeveigegsllcpftclts
    nikigkffhaniysyvahdcvigdyvtfapgakcngnihiedhayigtgavikqgtpdkp
    liigkgaivgmgavvtksvpagvtvvgnparile
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4m9cE (E:)
    mtmiigvygasgfgkevmplvrqqfptlskeqfafiddglsgttlngypvlsyldfiskp
    adhkavtiaiansvvreklvsllekdgvqhlavqstntvildeveigegsllcpftclts
    nikigkffhaniysyvahdcvigdyvtfapgakcngnihiedhayigtgavikqgtpdkp
    liigkgaivgmgavvtksvpagvtvvgnparilerk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m9cE (E:)
    tmiigvygasgfgkevmplvrqqfptlskeqfafiddglsgttlngypvlsyldfiskpa
    dhkavtiaiansvvreklvsllekdgvqhlavqstntvildeveigegsllcpftcltsn
    ikigkffhaniysyvahdcvigdyvtfapgakcngnihiedhayigtgavikqgtpdkpl
    iigkgaivgmgavvtksvpagvtvvgnparil
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4m9cF (F:)
    mtmiigvygasgfgkevmplvrqqfptlskeqfafiddglsgttlngypvlsyldfiskp
    adhkavtiaiansvvreklvsllekdgvqhlavqstntvildeveigegsllcpftclts
    nikigkffhaniysyvahdcvigdyvtfapgakcngnihiedhayigtgavikqgtpdkp
    liigkgaivgmgavvtksvpagvtvvgnparilerk