PDB entry 4m9a

View 4m9a on RCSB PDB site
Description: Crystal structure of Acyl-coA dehydrogenase from Burkholderia thailandensis E264
Class: oxidoreductase
Keywords: SSGCID, structural genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, acyl-coA dehydrogenase, FAD, FADH2, OXIDOREDUCTASE
Deposited on 2013-08-14, released 2013-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.189
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA dehydrogenase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_II1803
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m9aa1, d4m9aa2
  • Chain 'B':
    Compound: acyl-CoA dehydrogenase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_II1803
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m9ab1, d4m9ab2
  • Chain 'C':
    Compound: acyl-CoA dehydrogenase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_II1803
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m9ac1, d4m9ac2
  • Chain 'D':
    Compound: acyl-CoA dehydrogenase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_II1803
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m9ad1, d4m9ad2
  • Heterogens: FDA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m9aA (A:)
    mahhhhhhmddlytedqrmildaarafcaevlapnaaqwdreshlpdevvaqmgelgflg
    mivpadwggsytdyvayalaleeiaagcascatlvsvhnsvgcgpvlnygtteqkerwlr
    dlasgktvgafsltephagseahnlrtraelrdgkwilngskqfvtngaraglaivfamt
    dpdegkrglsafvvptdtpgfivgkpekkmgirasdtcpitlencaipqenllgkrgegl
    kialsnleggrigiaaqatgiaraafdrarryarervqfgkpiaehqaiaeklanmatqi
    naarllthhaarlrtaglpclseasqaklfasemaeavcsdaiqihggygflvdyeverh
    yrdaritqiyegtsevqrmviarql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m9aA (A:)
    ddlytedqrmildaarafcaevlapnaaqwdreshlpdevvaqmgelgflgmivpadwgg
    sytdyvayalaleeiaagcascatlvsvhnsvgcgpvlnygtteqkerwlrdlasgktvg
    afsltephhnlrtraelrdgkwilngskqfvtngaraglaivfamtdpdegkrglsafvv
    ptdtpgfivgkpekkmgirasdtcpitlencaipqenllgkrgeglkialsnleggrigi
    aaqatgiaraafdrarryarervqfgkpiaehqaiaeklanmatqinaarllthhaarlr
    taglpclseasqaklfasemaeavcsdaiqihggygflvdyeverhyrdaritqiyegts
    evqrmviarql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m9aB (B:)
    mahhhhhhmddlytedqrmildaarafcaevlapnaaqwdreshlpdevvaqmgelgflg
    mivpadwggsytdyvayalaleeiaagcascatlvsvhnsvgcgpvlnygtteqkerwlr
    dlasgktvgafsltephagseahnlrtraelrdgkwilngskqfvtngaraglaivfamt
    dpdegkrglsafvvptdtpgfivgkpekkmgirasdtcpitlencaipqenllgkrgegl
    kialsnleggrigiaaqatgiaraafdrarryarervqfgkpiaehqaiaeklanmatqi
    naarllthhaarlrtaglpclseasqaklfasemaeavcsdaiqihggygflvdyeverh
    yrdaritqiyegtsevqrmviarql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m9aB (B:)
    ddlytedqrmildaarafcaevlapnaaqwdreshlpdevvaqmgelgflgmivpadwgg
    sytdyvayalaleeiaagcascatlvsvhnsvgcgpvlnygtteqkerwlrdlasgktvg
    afsltephagseahnlrtraelrdgkwilngskqfvtngaraglaivfamtdpdegkrgl
    safvvptdtpgfivgkpekkmgirasdtcpitlencaipqenllgkrgeglkialsnleg
    grigiaaqatgiaraafdrarryarervqfgkpiaehqaiaeklanmatqinaarllthh
    aarlrtaglpclseasqaklfasemaeavcsdaiqihggygflvdyeverhyrdaritqi
    yegtsevqrmviarql
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4m9aC (C:)
    mahhhhhhmddlytedqrmildaarafcaevlapnaaqwdreshlpdevvaqmgelgflg
    mivpadwggsytdyvayalaleeiaagcascatlvsvhnsvgcgpvlnygtteqkerwlr
    dlasgktvgafsltephagseahnlrtraelrdgkwilngskqfvtngaraglaivfamt
    dpdegkrglsafvvptdtpgfivgkpekkmgirasdtcpitlencaipqenllgkrgegl
    kialsnleggrigiaaqatgiaraafdrarryarervqfgkpiaehqaiaeklanmatqi
    naarllthhaarlrtaglpclseasqaklfasemaeavcsdaiqihggygflvdyeverh
    yrdaritqiyegtsevqrmviarql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m9aC (C:)
    ddlytedqrmildaarafcaevlapnaaqwdreshlpdevvaqmgelgflgmivpadwgg
    sytdyvayalaleeiaagcascatlvsvhnsvgcgpvlnygtteqkerwlrdlasgktvg
    afsltephahnlrtraelrdgkwilngskqfvtngaraglaivfamtdpdegkrglsafv
    vptdtpgfivgkpekkmgirasdtcpitlencaipqenllgkrgeglkialsnleggrig
    iaaqatgiaraafdrarryarervqfgkpiaehqaiaeklanmatqinaarllthhaarl
    rtaglpclseasqaklfasemaeavcsdaiqihggygflvdyeverhyrdaritqiyegt
    sevqrmviarql
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4m9aD (D:)
    mahhhhhhmddlytedqrmildaarafcaevlapnaaqwdreshlpdevvaqmgelgflg
    mivpadwggsytdyvayalaleeiaagcascatlvsvhnsvgcgpvlnygtteqkerwlr
    dlasgktvgafsltephagseahnlrtraelrdgkwilngskqfvtngaraglaivfamt
    dpdegkrglsafvvptdtpgfivgkpekkmgirasdtcpitlencaipqenllgkrgegl
    kialsnleggrigiaaqatgiaraafdrarryarervqfgkpiaehqaiaeklanmatqi
    naarllthhaarlrtaglpclseasqaklfasemaeavcsdaiqihggygflvdyeverh
    yrdaritqiyegtsevqrmviarql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m9aD (D:)
    ddlytedqrmildaarafcaevlapnaaqwdreshlpdevvaqmgelgflgmivpadwgg
    sytdyvayalaleeiaagcascatlvsvhnsvgcgpvlnygtteqkerwlrdlasgktvg
    afsltephnlrtraelrdgkwilngskqfvtngaraglaivfamtdpdkrglsafvvptd
    tpgfivgkpekkmgirasdtcpitlencaipqenllgkrgeglkialsnleggrigiaaq
    atgiaraafdrarryarerkpiaehqaiaeklanmatqinaarllthhaarlrtaglpcl
    seasqaklfasemaeavcsdaiqihggygflvdyeverhyrdaritqiyegtsevqrmvi
    arql