PDB entry 4m99

View 4m99 on RCSB PDB site
Description: Acetyltransferase domain of PglB from Neisseria gonorrhoeae FA1090 in complex with acetyl coenzyme A
Class: Transferase
Keywords: left-handed beta-helix, rossmann fold, acetyltransferase, Transferase
Deposited on 2013-08-14, released 2013-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.202
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pilin glycosylation protein
    Species: Neisseria gonorrhoeae [TaxId:242231]
    Gene: NGO0085
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m99a_
  • Chain 'B':
    Compound: Pilin glycosylation protein
    Species: Neisseria gonorrhoeae [TaxId:242231]
    Gene: NGO0085
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m99b_
  • Chain 'C':
    Compound: Pilin glycosylation protein
    Species: Neisseria gonorrhoeae [TaxId:242231]
    Gene: NGO0085
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m99c_
  • Heterogens: ACO, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m99A (A:)
    magnrklavigagghgkvvaelaaalgtygeivflddrtqgsvngfpvigttlllensls
    peqfditvavgnnrirrqitenaaalgfklpvlihpdatvspsaiigqgsvvmakavvqa
    gsvlkdgvivntaatvdhdclldafvhispgahlsgntrigeesrigtgacsrqqttvgs
    gvtagagavivcdipdgmtvagnpakpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m99A (A:)
    gnrklavigagghgkvvaelaaalgtygeivflddrtqgsvngfpvigttlllenslspe
    qfditvavgnnrirrqitenaaalgfklpvlihpdatvspsaiigqgsvvmakavvqags
    vlkdgvivntaatvdhdclldafvhispgahlsgntrigeesrigtgacsrqqttvgsgv
    tagagavivcdipdgmtvagnpakpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m99B (B:)
    magnrklavigagghgkvvaelaaalgtygeivflddrtqgsvngfpvigttlllensls
    peqfditvavgnnrirrqitenaaalgfklpvlihpdatvspsaiigqgsvvmakavvqa
    gsvlkdgvivntaatvdhdclldafvhispgahlsgntrigeesrigtgacsrqqttvgs
    gvtagagavivcdipdgmtvagnpakpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m99B (B:)
    gnrklavigagghgkvvaelaaalgtygeivflddrtqgsvngfpvigttlllnslspeq
    fditvavgnnrirrqitenaaalgfklpvlihpdatvspsaiigqgsvvmakavvqagsv
    lkdgvivntaatvdhdclldafvhispgahlsgntrigeesrigtgacsrqqttvgsgvt
    agagavivcdipdgmtvagnpakpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4m99C (C:)
    magnrklavigagghgkvvaelaaalgtygeivflddrtqgsvngfpvigttlllensls
    peqfditvavgnnrirrqitenaaalgfklpvlihpdatvspsaiigqgsvvmakavvqa
    gsvlkdgvivntaatvdhdclldafvhispgahlsgntrigeesrigtgacsrqqttvgs
    gvtagagavivcdipdgmtvagnpakpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m99C (C:)
    gnrklavigagghgkvvaelaaalgtygeivflddrtqgsvngfpvigttlllenslspe
    qfditvavgnnrirrqitenaaalgfklpvlihpdatvspsaiigqgsvvmakavvqags
    vlkdgvivntaatvdhdclldafvhispgahlsgntrigeesrigtgacsrqqttvgsgv
    tagagavivcdipdgmtvagnpakpl