PDB entry 4m98

View 4m98 on RCSB PDB site
Description: Acetyltransferase domain of PglB from Neisseria gonorrhoeae FA1090
Class: transferase
Keywords: left-handed beta-helix, rossmann fold, acetyltransferase, Transferase
Deposited on 2013-08-14, released 2013-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pilin glycosylation protein
    Species: Neisseria gonorrhoeae [TaxId:242231]
    Gene: NGO0085
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m98a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m98A (A:)
    magnrklavigagghgkvvaelaaalgtygeivflddrtqgsvngfpvigttlllensls
    peqfditvavgnnrirrqitenaaalgfklpvlihpdatvspsaiigqgsvvmakavvqa
    gsvlkdgvivntaatvdhdclldafvhispgahlsgntrigeesrigtgacsrqqttvgs
    gvtagagavivcdipdgmtvagnpakpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m98A (A:)
    nrklavigagghgkvvaelaaalgtygeivflddrtqgsvngfpvigttlllenslspeq
    fditvavgnnrirrqitenaaalgfklpvlihpdatvspsaiigqgsvvmakavvqagsv
    lkdgvivntaatvdhdclldafvhispgahlsgntrigeesrigtgacsrqqttvgsgvt
    agagavivcdipdgmtvagnpakpl